BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 27 0.51 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 27 0.89 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 2.1 AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 25 3.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 6.3 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 8.3 AF269154-1|AAF91399.1| 76|Anopheles gambiae transcription fact... 23 8.3 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 27.5 bits (58), Expect = 0.51 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 102 NS*GWRCQPVQVHNTPYHQQNY 167 +S G C P QVH TP H Y Sbjct: 167 HSQGQECYPEQVHQTPQHMAMY 188 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 26.6 bits (56), Expect = 0.89 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -2 Query: 584 SKTVRNIQETHLNDKVKYNLKSTCFNVSVFKHTVTS 477 ++T+RN+++ + +Y L + FN +FK+ ++ Sbjct: 337 NRTLRNLKKDRMKYLRRYRLNRSAFNFRLFKYAASA 372 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 289 TKSLSLSLYPYVCLNL*NYATDFDAV 366 T S++LS P + LN NY FDAV Sbjct: 317 THSMTLSWAPPIRLNPINYKISFDAV 342 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 282 LCSDWTRTIICPKKDIDIKSK 220 L SD TI CP+K+I+ K++ Sbjct: 77 LSSDGILTITCPRKEIEQKNE 97 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 6.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 561 LYVSDSLTSIIHVLRY*LFHPTYSL 635 LYV D I V Y L HP +SL Sbjct: 132 LYVLDPFNPIRRVAIYILVHPLFSL 156 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 288 FILCSDWTRTIICPKKDIDI 229 F + +D TR + PKK IDI Sbjct: 325 FAMAADGTRVPLDPKKGIDI 344 >AF269154-1|AAF91399.1| 76|Anopheles gambiae transcription factor proboscipedia protein. Length = 76 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 177 KLSNNFAGGRAYCEPARVGTAILTNSTAKQMFVW 76 +L F + C P R+ A + T +Q+ VW Sbjct: 38 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVW 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 826,282 Number of Sequences: 2352 Number of extensions: 16625 Number of successful extensions: 36 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -