BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC071560-1|AAH71560.1| 1024|Homo sapiens tubulin, gamma complex ... 31 6.4 BC046182-1|AAH46182.1| 477|Homo sapiens TUBGCP5 protein protein. 31 6.4 AF272884-1|AAK77662.1| 1024|Homo sapiens gamma-tubulin complex c... 31 6.4 AB067486-1|BAB67792.2| 1032|Homo sapiens KIAA1899 protein protein. 31 6.4 AL034349-4|CAI23056.1| 71|Homo sapiens protein tyrosine phosph... 30 8.5 >BC071560-1|AAH71560.1| 1024|Homo sapiens tubulin, gamma complex associated protein 5 protein. Length = 1024 Score = 30.7 bits (66), Expect = 6.4 Identities = 12/49 (24%), Positives = 30/49 (61%) Frame = +2 Query: 98 VEFVRMAVPTRAGSQYALPPAKLLLNFESIISIRYYLPLMVLDLISISF 244 V F+ + + G +Y ++L ++FE++ + + LP+ +LD +++S+ Sbjct: 755 VSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSY 803 >BC046182-1|AAH46182.1| 477|Homo sapiens TUBGCP5 protein protein. Length = 477 Score = 30.7 bits (66), Expect = 6.4 Identities = 12/49 (24%), Positives = 30/49 (61%) Frame = +2 Query: 98 VEFVRMAVPTRAGSQYALPPAKLLLNFESIISIRYYLPLMVLDLISISF 244 V F+ + + G +Y ++L ++FE++ + + LP+ +LD +++S+ Sbjct: 208 VSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSY 256 >AF272884-1|AAK77662.1| 1024|Homo sapiens gamma-tubulin complex component GCP5 protein. Length = 1024 Score = 30.7 bits (66), Expect = 6.4 Identities = 12/49 (24%), Positives = 30/49 (61%) Frame = +2 Query: 98 VEFVRMAVPTRAGSQYALPPAKLLLNFESIISIRYYLPLMVLDLISISF 244 V F+ + + G +Y ++L ++FE++ + + LP+ +LD +++S+ Sbjct: 755 VSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSY 803 >AB067486-1|BAB67792.2| 1032|Homo sapiens KIAA1899 protein protein. Length = 1032 Score = 30.7 bits (66), Expect = 6.4 Identities = 12/49 (24%), Positives = 30/49 (61%) Frame = +2 Query: 98 VEFVRMAVPTRAGSQYALPPAKLLLNFESIISIRYYLPLMVLDLISISF 244 V F+ + + G +Y ++L ++FE++ + + LP+ +LD +++S+ Sbjct: 763 VSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSY 811 >AL034349-4|CAI23056.1| 71|Homo sapiens protein tyrosine phosphatase, receptor type, K protein. Length = 71 Score = 30.3 bits (65), Expect = 8.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 599 ITILTFSPYLFAGSIWGYSSYARTGWRAH 685 + +L SP+ GS G S A GWRAH Sbjct: 13 VALLLLSPWPLLGSAQGQFSAASLGWRAH 41 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,004,055 Number of Sequences: 237096 Number of extensions: 2240338 Number of successful extensions: 3586 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3586 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9869080686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -