BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069321-1|AAL39466.1| 562|Drosophila melanogaster LD03740p pro... 30 4.2 AF220496-1|AAF33245.1| 781|Drosophila melanogaster arm repeat p... 30 4.2 AE013599-18|ABI31015.1| 767|Drosophila melanogaster CG17484-PB,... 30 4.2 AE013599-17|EAA45985.1| 781|Drosophila melanogaster CG17484-PA,... 30 4.2 BT023816-1|AAZ66323.1| 379|Drosophila melanogaster LP21446p pro... 29 9.8 >AY069321-1|AAL39466.1| 562|Drosophila melanogaster LD03740p protein. Length = 562 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 659 YARTGWRAHGLNLRKFV--NTSPN*SSAPQNLRPDRKRPLRRSGEKRYE 799 Y + GW+ + F NT P S+P N+ RP+ G RYE Sbjct: 480 YKKNGWKEQDFVSKHFTAHNTPP---SSPNNVNNTLNRPMASQGRTRYE 525 >AF220496-1|AAF33245.1| 781|Drosophila melanogaster arm repeat protein protein. Length = 781 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 659 YARTGWRAHGLNLRKFV--NTSPN*SSAPQNLRPDRKRPLRRSGEKRYE 799 Y + GW+ + F NT P S+P N+ RP+ G RYE Sbjct: 699 YKKNGWKEQDFVSKHFTAHNTPP---SSPNNVNNTLNRPMASQGRTRYE 744 >AE013599-18|ABI31015.1| 767|Drosophila melanogaster CG17484-PB, isoform B protein. Length = 767 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 659 YARTGWRAHGLNLRKFV--NTSPN*SSAPQNLRPDRKRPLRRSGEKRYE 799 Y + GW+ + F NT P S+P N+ RP+ G RYE Sbjct: 685 YKKNGWKEQDFVSKHFTAHNTPP---SSPNNVNNTLNRPMASQGRTRYE 730 >AE013599-17|EAA45985.1| 781|Drosophila melanogaster CG17484-PA, isoform A protein. Length = 781 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 659 YARTGWRAHGLNLRKFV--NTSPN*SSAPQNLRPDRKRPLRRSGEKRYE 799 Y + GW+ + F NT P S+P N+ RP+ G RYE Sbjct: 699 YKKNGWKEQDFVSKHFTAHNTPP---SSPNNVNNTLNRPMASQGRTRYE 744 >BT023816-1|AAZ66323.1| 379|Drosophila melanogaster LP21446p protein. Length = 379 Score = 28.7 bits (61), Expect = 9.8 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 584 FNHTCITILTFSPYLFAG-SIWGYSSYARTGWRAHGLNLRKFVNTSPN*SSAPQN 745 FNH C I+ SPY+ +G + S A + + + T P SS PQN Sbjct: 42 FNHVCCDIIIKSPYIPSGPNEESDSESASSSTEEENIPTFIYFPTRPTVSSEPQN 96 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,445,389 Number of Sequences: 53049 Number of extensions: 692228 Number of successful extensions: 1383 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1383 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3736869864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -