BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 25 1.1 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 25 1.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 25 1.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 7.6 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 199 VLFTSYGFRLNIYIFFRTNDRTCPITT*YKTKSLSL 306 V+F + +RL I F T D P K +S++L Sbjct: 151 VIFVTINYRLGILGFLSTEDEVVPGNMGLKDQSMAL 186 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 199 VLFTSYGFRLNIYIFFRTNDRTCPITT*YKTKSLSL 306 V+F + +RL I F T D P K +S++L Sbjct: 22 VIFVTINYRLGILGFLSTEDEVVPGNMGLKDQSMAL 57 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 199 VLFTSYGFRLNIYIFFRTNDRTCPITT*YKTKSLSL 306 V+F + +RL I F T D P K +S++L Sbjct: 151 VIFVTINYRLGILGFLSTEDEVVPGNMGLKDQSMAL 186 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 7.6 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 6/57 (10%) Frame = +3 Query: 6 SHITVDTGGKSQLYC------ISAVPP*KPKQTSVSR*NS*GWRCQPVQVHNTPYHQ 158 S ++ D+ +YC + V + + V R S GWR VH TP+ Q Sbjct: 92 SFLSSDSASSGNVYCKCDDCLLGIVDDYQRNPSVVGRKKSSGWRKLRNIVHWTPFFQ 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,371 Number of Sequences: 438 Number of extensions: 4867 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -