BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80640.1 68414.m09463 protein kinase family protein contains ... 31 1.2 At3g45640.1 68416.m04929 mitogen-activated protein kinase, putat... 28 6.3 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 28 6.3 At3g57200.1 68416.m06368 hypothetical protein 28 8.3 >At1g80640.1 68414.m09463 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 427 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 469 GGSLVTVCLKTDTLKHVLFKLYFTLSFKCVSCMFLTVLL 585 G +V V L+ D K +L L + S CV+ MFL LL Sbjct: 55 GPPIVKVVLRQDLNKKILIALIVSSSLLCVTVMFLVYLL 93 >At3g45640.1 68416.m04929 mitogen-activated protein kinase, putative / MAPK, putative (MPK3) identical to mitogen-activated protein kinase homolog (AtMPK3)[Arabidopsis thaliana] SWISS-PROT:Q39023; PMID:12119167 Length = 370 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 53 IGCPTLKTQTNICFAVEFVRMAVPTRAGSQYALPPAKLL--LNFESIISIRYYLP 211 I C L T+TN A++ + A ++ L KLL L+ E+II+IR +P Sbjct: 51 IVCSVLDTETNELVAMKKIANAFDNHMDAKRTLREIKLLRHLDHENIIAIRDVVP 105 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -3 Query: 787 LAGSSQWSLPIRS*ILRSTALVRASVNKFSQVEPVSSPTGPGVTGIAPYATSE 629 LAG + ++ S + S+ + AS +F + P SP+ V I+PY E Sbjct: 607 LAGDTSYNRASGSSRIFSSKRLTASSREFGTIGPTPSPSPSSVGPISPYCAPE 659 >At3g57200.1 68416.m06368 hypothetical protein Length = 504 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +2 Query: 56 GCPTLKTQTNICFAVEFVRMAVPTRAGSQYAL---PPAKLLLNFESIISIRYYLPLMVL- 223 GC K CF +EF R V + +++ + KL L + I++ R Y P++++ Sbjct: 370 GCKPTKVDVKRCFMLEFDRARVQRKCCNEHVVWTDEKLKLKLLRKGILT-RIYAPMVIIQ 428 Query: 224 DLISISFFGQMIV 262 +L F +++ Sbjct: 429 ELREAGVFSSVVI 441 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,594,630 Number of Sequences: 28952 Number of extensions: 336471 Number of successful extensions: 734 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -