BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30332X (446 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 24 2.8 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 3.7 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 6.5 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 23 6.5 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 22 8.6 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.0 bits (52), Expect = 1.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 100 SQNQHGQVPSWILWQTWHEKCPL*KEQE 183 SQ Q Q P +LW T CP ++++ Sbjct: 407 SQQQQQQQPQQLLWTTVVRSCPSQRQRQ 434 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.8 bits (49), Expect = 2.8 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 98 HHRINMDKYHPGYFGK--LGMRNVHFRKNKKV 187 +HRI +D+ H FG+ MR+ +R + + Sbjct: 111 NHRIQLDENHDPLFGRALFAMRDTRWRNMRTI 142 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.4 bits (48), Expect = 3.7 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +3 Query: 384 DNQGCGWCLCTI 419 D + C WC CT+ Sbjct: 362 DRESCRWCECTL 373 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 Query: 83 AGGEHHHRINMDKYHPGYFG 142 A HHH + +HPG G Sbjct: 153 AAAMHHHHHHPHHHHPGLTG 172 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 22.6 bits (46), Expect = 6.5 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 96 CSPPALPRPPGCLRCFPI 43 C+PP +P P C P+ Sbjct: 38 CNPPGIPGGPACAGLKPM 55 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 22.2 bits (45), Expect = 8.6 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 396 CGWCLCTICVNNK 434 C W LC +C + K Sbjct: 33 CVWMLCEVCCSRK 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,464 Number of Sequences: 2352 Number of extensions: 10411 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -