BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30332X (446 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087079-7|AAK27870.1| 145|Caenorhabditis elegans Hypothetical ... 101 2e-22 AC087079-8|AAK27871.1| 88|Caenorhabditis elegans Hypothetical ... 68 4e-12 AC006675-11|AAK84552.1| 326|Caenorhabditis elegans Serpentine r... 29 2.0 Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical pr... 28 2.7 U41995-1|AAA83459.1| 301|Caenorhabditis elegans Serpentine rece... 28 2.7 AC006672-8|AAY43997.1| 125|Caenorhabditis elegans Hypothetical ... 27 6.2 >AC087079-7|AAK27870.1| 145|Caenorhabditis elegans Hypothetical protein Y37E3.8a protein. Length = 145 Score = 101 bits (243), Expect = 2e-22 Identities = 44/82 (53%), Positives = 53/82 (64%) Frame = +2 Query: 2 TRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNVHFRKNK 181 TRKLRGHVS NAGG+HHHRIN DKYHPGYFGK+GMR H KN+ Sbjct: 8 TRKLRGHVSHGHGRIGKHRKHPGGRGNAGGQHHHRINRDKYHPGYFGKVGMRVFHLNKNQ 67 Query: 182 KVCPVLNVDKRWTLVSEQTRLK 247 CP +NV++ W+LV ++ R K Sbjct: 68 HYCPTVNVERLWSLVPQEVRDK 89 Score = 67.7 bits (158), Expect = 4e-12 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +1 Query: 256 APDGKGPVINIVKAGYYKLLCKGKLPKQPVIV*AKFFSKSAEKIIKDVGGACVLSA 423 A GK PVI+ K GY+K+L KG LP+ P+IV A+FFS AE+ IK GGACVL A Sbjct: 90 ATGGKSPVIDCTKLGYFKVLGKGLLPETPLIVKARFFSHEAEQKIKKAGGACVLVA 145 >AC087079-8|AAK27871.1| 88|Caenorhabditis elegans Hypothetical protein Y37E3.8b protein. Length = 88 Score = 67.7 bits (158), Expect = 4e-12 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +1 Query: 256 APDGKGPVINIVKAGYYKLLCKGKLPKQPVIV*AKFFSKSAEKIIKDVGGACVLSA 423 A GK PVI+ K GY+K+L KG LP+ P+IV A+FFS AE+ IK GGACVL A Sbjct: 33 ATGGKSPVIDCTKLGYFKVLGKGLLPETPLIVKARFFSHEAEQKIKKAGGACVLVA 88 Score = 37.1 bits (82), Expect = 0.006 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 152 MRNVHFRKNKKVCPVLNVDKRWTLVSEQTRLK 247 MR H KN+ CP +NV++ W+LV ++ R K Sbjct: 1 MRVFHLNKNQHYCPTVNVERLWSLVPQEVRDK 32 >AC006675-11|AAK84552.1| 326|Caenorhabditis elegans Serpentine receptor, class t protein31 protein. Length = 326 Score = 28.7 bits (61), Expect = 2.0 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -3 Query: 270 LAIWSNAYFSLVCSETNVQRLSTFKTGQTFLFFLKWTFLMPSLPKYPGWYLSM 112 L +W+++ + TN TFK+ F+F TFL+ LP G Y ++ Sbjct: 116 LGLWASSCLVAMLLVTNRLLDFTFKSAANFMFDKNRTFLVLILPTIYGLYFAI 168 >Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical protein C56A3.1 protein. Length = 393 Score = 28.3 bits (60), Expect = 2.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 87 PALPRPPGCLRCFPIRPCP 31 PA P+ P C C P +PCP Sbjct: 50 PACPQAPSCPVCPPPQPCP 68 >U41995-1|AAA83459.1| 301|Caenorhabditis elegans Serpentine receptor, class x protein47 protein. Length = 301 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 214 TLIYVQNWTDLLVLSKVDISHAKFAKVSR 128 TL + NWT L LSKV H F ++R Sbjct: 16 TLGVIANWTVFLFLSKVPSIHKSFGSLTR 44 >AC006672-8|AAY43997.1| 125|Caenorhabditis elegans Hypothetical protein K08D12.7 protein. Length = 125 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 223 SL*TDEAEVCIAPDGKGPVINIVKAGYYK 309 S+ +EA +AP+G G N+ +GY K Sbjct: 51 SMAVEEAPATVAPEGAGAQSNVESSGYRK 79 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,104,868 Number of Sequences: 27780 Number of extensions: 217424 Number of successful extensions: 713 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -