BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30332X (446 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 4.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 4.6 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 6.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 6.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.1 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 4.6 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -3 Query: 243 SLVCSETNVQRLSTF 199 SLVC++T + +L+ F Sbjct: 65 SLVCADTRLNKLAVF 79 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 4.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 419 DSTQAPPTSLIIFSA 375 D T PPT+ ++FS+ Sbjct: 140 DQTGIPPTTCLVFSS 154 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.0 bits (42), Expect = 6.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 214 TLIYVQNWTDLLV 176 T Y+ NWTDL++ Sbjct: 28 TEYYLPNWTDLVL 40 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.0 bits (42), Expect = 6.1 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -3 Query: 261 WSNAYFSLVCSETNVQRLSTFKTGQTFLFFLKWTF 157 W YFS+VC L FK F +W + Sbjct: 7 WLILYFSIVCQAKAHYSLRDFK-ANIFQVKYQWKY 40 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 215 WTLVSEQTRLKYALLQMARAPSSILS-KLDT 304 WTLVS +++ + PSS+ K++T Sbjct: 1544 WTLVSNSVKMQRRFVVTNLQPSSVYQLKVET 1574 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 215 WTLVSEQTRLKYALLQMARAPSSILS-KLDT 304 WTLVS +++ + PSS+ K++T Sbjct: 1540 WTLVSNSVKMQRRFVVTNLQPSSVYQLKVET 1570 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,664 Number of Sequences: 438 Number of extensions: 2542 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -