BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30331 (553 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 30 0.058 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 26 0.95 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 0.95 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 6.7 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 8.8 AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding pr... 23 8.8 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 29.9 bits (64), Expect = 0.058 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 263 TRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRASRAENPEPEVPP 406 T RS ST N TIR R TR P P V +R P PP Sbjct: 416 TTRSTSTKLSNCSMRTIRTTVRSTRAPSPGPIVYYPARETLPRLAQPP 463 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 25.8 bits (54), Expect = 0.95 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 323 RRCTRVPEESPEVCRASRAENPEPEVPPP 409 R+C+R SP+ A +++N P VPPP Sbjct: 44 RKCSR--NGSPKFAPAVQSKNRMPPVPPP 70 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 0.95 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 14 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 133 N++ R +EE ++M NE+ K + QK+ Q + S Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEHTVVGS 243 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.0 bits (47), Expect = 6.7 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 110 QAKNALESYCFSMKSTMED--EKLKEKISDSDKQTILDKCNDTIKWLDSNRWPTRRSMST 283 +AK E + +K E E+LKE + + +Q L I+ L++ + + T Sbjct: 675 KAKRWDEKHMAQLKLQKEKITEELKEVMKKTRRQGELTTVESQIRGLENRLKYSMNDLET 734 Query: 284 SRKN 295 S+KN Sbjct: 735 SKKN 738 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 66 QRSTETRMTSKRRPSRPRMHWNLTASA 146 Q + ET R P+R W+ TA+A Sbjct: 409 QLTEETYQEGTRDPARTPFQWDSTANA 435 >AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding protein OBPjj5c protein. Length = 155 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 338 VPEESPEVCRASRAENPEPEVPPP 409 +PE+ E CRA + P VP P Sbjct: 5 LPEQVIETCRARPLPSVIPGVPDP 28 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,034 Number of Sequences: 2352 Number of extensions: 10937 Number of successful extensions: 39 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -