BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30330 (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 168 3e-42 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.56 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.3 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 3.0 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 3.0 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 3.0 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 3.0 SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) 28 5.2 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 5.2 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 5.2 SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) 28 6.9 SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) 27 9.1 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 168 bits (409), Expect = 3e-42 Identities = 81/98 (82%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = +1 Query: 223 QTREHLLVF-FTIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 399 +T EH+ +F IKEFEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 400 HIGLGVKCSKEVATAIRCAIILAKLSVLPVRRGYWGTR 513 H+GLGVKCSKEVATAIR AIILAKLSV+PVRRGYWG + Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNK 121 Score = 76.6 bits (180), Expect = 2e-14 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 504 GYKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSA 614 G KIGKPHTVPCKVTGKCGS VRLIPAPRGTGIVSA Sbjct: 119 GNKIGKPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSA 155 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 173 WVPVTKLGRLVREGKIDKLESIYLFSLQSK 262 WVPVTKLGRLV++ KI LE IYLFSL K Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIK 37 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 474 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 295 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 294 RAEEEI 277 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 474 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 295 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 294 RAEEEI 277 R ++E+ Sbjct: 577 RNQDEL 582 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 447 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 316 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) Length = 389 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/72 (20%), Positives = 27/72 (37%) Frame = +2 Query: 371 HLLPLATTTVILVWV*SAARKSPLPFDALLSLLSCLFYQFEEVTGVQDRKATYRPLQGHR 550 H + T + W+ R + ++ ++L LFY T P H Sbjct: 199 HTISTWTIRGVSRWISYLTRCFTVLYEVFHNILYGLFYSITRGEPAYHSYWTMSPYSAHA 258 Query: 551 QVWFCNSPADSC 586 Q + CN+ ++C Sbjct: 259 QSYICNTSCEAC 270 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 351 TAHTFQGICCHWRQQRSYW 407 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 349 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 438 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) Length = 174 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 168 KSGFLSPNSAVLFAKEKSTNSRAFTCFLYNQ 260 KSG L ++F E +S+AF C LYN+ Sbjct: 56 KSGRLGGMPNIVFNSEYQWSSKAFLCTLYNK 86 >SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) Length = 956 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +2 Query: 536 LQGHRQVWFCNS-PADSCPS 592 LQ HR WFC S P +CP+ Sbjct: 87 LQSHRHPWFCVSCPTVTCPT 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,769,010 Number of Sequences: 59808 Number of extensions: 431331 Number of successful extensions: 1247 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1246 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -