BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30327 (471 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 121 3e-28 SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) 34 0.052 SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) 29 1.9 SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_50276| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 121 bits (291), Expect = 3e-28 Identities = 63/99 (63%), Positives = 74/99 (74%), Gaps = 16/99 (16%) Frame = +3 Query: 3 AFQKQATVFLNRKGGM----KRKDMRHHKNVGLGFKTP------------REAIEGTYID 134 A+QKQA +F NRK + K+KD+R +NVGLGFKTP REAIEGTYID Sbjct: 8 AYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREAIEGTYID 67 Query: 135 KKCPFTXNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYL 251 KKCPFT NVSIRGRILTG+ + MKM+RTI+IRRDYLHY+ Sbjct: 68 KKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYLHYI 106 Score = 91.5 bits (217), Expect = 3e-19 Identities = 35/48 (72%), Positives = 45/48 (93%) Frame = +2 Query: 254 QYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 397 +YNRFEKRH+N++ H SPCFRD+ +GD++T+G+CRPLSKTVRFNVLKV Sbjct: 108 KYNRFEKRHKNLAAHCSPCFRDIALGDLITVGQCRPLSKTVRFNVLKV 155 >SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) Length = 73 Score = 34.3 bits (75), Expect = 0.052 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +2 Query: 329 GDIVTIGECRPLSKTVRFNVLKV 397 GD+V I ECRPLSK +FNV ++ Sbjct: 29 GDVVRIKECRPLSKMKKFNVEEI 51 >SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) Length = 522 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +2 Query: 206 DAENYRDPPRLPSLPTQYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGE-CRPLSKTVRF 382 D +N++ PP LP +++ KR R HL R + + E C + ++++ Sbjct: 277 DGQNFQGPPTSTVLPRRHSGDRKRQRRTPYHLEEVLRRLHANGLTAQREKCEFMQPSLKY 336 >SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 132 QCRYPQSPLWEF*SLNQHSYGDACP 58 +C QS LWE SL QH Y + P Sbjct: 505 KCNALQSSLWELKSLQQHYYPEVSP 529 >SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 28.3 bits (60), Expect = 3.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 322 HVPEARRQMHGHIPVPFLEP 263 HV +A R HG++P+P L P Sbjct: 82 HVDQACRSFHGNLPLPVLAP 101 >SB_50276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 236 LPSLPTQYNRFEKRHRNMSVHLSPCF 313 LPSL Y R E H +SVHL P F Sbjct: 162 LPSLCESYIRGEICHDCLSVHLCPAF 187 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,924,662 Number of Sequences: 59808 Number of extensions: 268045 Number of successful extensions: 620 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -