BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30327 (471 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1421|AAM71028.1| 155|Drosophila melanogaster CG8857-PC... 124 6e-29 AE013599-1420|AAF58552.1| 155|Drosophila melanogaster CG8857-PA... 124 6e-29 AE013599-1422|AAM71029.1| 154|Drosophila melanogaster CG8857-PB... 112 3e-25 AL021086-2|CAA15933.1| 995|Drosophila melanogaster EG:86E4.2 pr... 27 9.7 >AE013599-1421|AAM71028.1| 155|Drosophila melanogaster CG8857-PC, isoform C protein. Length = 155 Score = 124 bits (299), Expect = 6e-29 Identities = 62/86 (72%), Positives = 72/86 (83%), Gaps = 3/86 (3%) Frame = +3 Query: 3 AFQKQATVFLNRK---GGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTXNVSIRG 173 AFQKQ V LNRK G K+K +R ++VGLGFKTPREAI+GTYIDKKCP+T +V IRG Sbjct: 8 AFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGDVRIRG 67 Query: 174 RILTGVVQKMKMQRTIVIRRDYLHYL 251 RILTGVV+K KMQRTIVIRRDYLH++ Sbjct: 68 RILTGVVRKAKMQRTIVIRRDYLHFV 93 Score = 94.3 bits (224), Expect = 7e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 254 QYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 397 +Y+RFEKRHRNMSVH SP FRDVE GDIVTIGECRPLSKTVRFNVLKV Sbjct: 95 KYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKV 142 >AE013599-1420|AAF58552.1| 155|Drosophila melanogaster CG8857-PA, isoform A protein. Length = 155 Score = 124 bits (299), Expect = 6e-29 Identities = 62/86 (72%), Positives = 72/86 (83%), Gaps = 3/86 (3%) Frame = +3 Query: 3 AFQKQATVFLNRK---GGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTXNVSIRG 173 AFQKQ V LNRK G K+K +R ++VGLGFKTPREAI+GTYIDKKCP+T +V IRG Sbjct: 8 AFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGDVRIRG 67 Query: 174 RILTGVVQKMKMQRTIVIRRDYLHYL 251 RILTGVV+K KMQRTIVIRRDYLH++ Sbjct: 68 RILTGVVRKAKMQRTIVIRRDYLHFV 93 Score = 94.3 bits (224), Expect = 7e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 254 QYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 397 +Y+RFEKRHRNMSVH SP FRDVE GDIVTIGECRPLSKTVRFNVLKV Sbjct: 95 KYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKV 142 >AE013599-1422|AAM71029.1| 154|Drosophila melanogaster CG8857-PB, isoform B protein. Length = 154 Score = 112 bits (269), Expect = 3e-25 Identities = 53/84 (63%), Positives = 67/84 (79%), Gaps = 1/84 (1%) Frame = +3 Query: 3 AFQKQ-ATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTXNVSIRGRI 179 +F+KQ A V + RK +K R ++ +GLGF+ P EAI+GTYIDKKCP+T +V IRGRI Sbjct: 9 SFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPAEAIDGTYIDKKCPWTGDVRIRGRI 68 Query: 180 LTGVVQKMKMQRTIVIRRDYLHYL 251 LTGVV+K KMQRTIVIRRDYLH++ Sbjct: 69 LTGVVRKAKMQRTIVIRRDYLHFV 92 Score = 94.3 bits (224), Expect = 7e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 254 QYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 397 +Y+RFEKRHRNMSVH SP FRDVE GDIVTIGECRPLSKTVRFNVLKV Sbjct: 94 KYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKV 141 >AL021086-2|CAA15933.1| 995|Drosophila melanogaster EG:86E4.2 protein. Length = 995 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 54 RKDMRHHKNVGLGFKTPREAIEGTYIDKKC 143 RK++ HH G T R++ GT+I K+C Sbjct: 953 RKELPHHLFACTGRSTLRDSPIGTFIRKRC 982 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,272,288 Number of Sequences: 53049 Number of extensions: 396847 Number of successful extensions: 866 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1601407269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -