BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30326X (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 101 2e-22 SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) 29 1.5 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 4.6 SB_44267| Best HMM Match : DUF602 (HMM E-Value=1.1e-29) 27 6.1 SB_27973| Best HMM Match : Fe-ADH (HMM E-Value=5.6e-06) 27 6.1 SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_12133| Best HMM Match : DUF827 (HMM E-Value=0.64) 27 8.0 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 101 bits (243), Expect = 2e-22 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = +3 Query: 309 EVRKVLQLFRLXQINNGVFIRLNKATVNMLRIAEPYIAWGYPNLKSVRELVYKRGF 476 +VRK+LQL RL QINNGVF+RLNKAT NMLRI +PYIA+GYPNLKSVREL+YKRG+ Sbjct: 101 KVRKILQLLRLRQINNGVFVRLNKATANMLRIVQPYIAFGYPNLKSVRELIYKRGY 156 Score = 72.5 bits (170), Expect = 2e-13 Identities = 34/79 (43%), Positives = 49/79 (62%) Frame = +2 Query: 17 EDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKE 196 +D K+P VPE++LK + L ++ K++EIFKRAE+YVKEYR KE Sbjct: 3 QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62 Query: 197 RDEIRLARQARNRGNYYVP 253 DE+R+ + A+ GN+YVP Sbjct: 63 VDELRMKKMAKKHGNFYVP 81 Score = 37.5 bits (83), Expect = 0.006 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +1 Query: 256 EAKLAFVIRIRGINQVSPKSVKFCNCL 336 EA+LAFVIRIRGIN VSPK K L Sbjct: 83 EARLAFVIRIRGINGVSPKVRKILQLL 109 >SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) Length = 957 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +3 Query: 291 YQPSFTEVRKVLQLFRLXQINNGVFIRLNKATVNMLRIAEPYIAWGYPNLKSVRELVY 464 YQ T + + L + IN G +N++ VN+ R A + YP++KSVR +Y Sbjct: 231 YQNGTTFFYEQVNLHKTVVINKGTDSIINES-VNLPRRARDSEKFVYPDIKSVRVTIY 287 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 119 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 244 R AI ++RE+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 3.5 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 119 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 244 R + ++REI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 191 KERDEIRLARQARNRGNYYVP 253 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 >SB_44267| Best HMM Match : DUF602 (HMM E-Value=1.1e-29) Length = 482 Score = 27.5 bits (58), Expect = 6.1 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 2 PVKGKEDSKKLP--AVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYV 175 P K KE SK + AV +S+LK + T ++ AI KKR + +Y+ Sbjct: 305 PAK-KESSKHIEKNAVKKSILKAPKRNAKKAATDAEQTTTKK--AIDKKRRRYNSRRRYI 361 Query: 176 KEYRIKERDEIRLARQARNR 235 + R R R R R Sbjct: 362 RRRRFTSRRRATRRRYTRRR 381 >SB_27973| Best HMM Match : Fe-ADH (HMM E-Value=5.6e-06) Length = 324 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 225 HAIVATTTFPGSQIGICHPNPWYQPSF 305 HAI + T P + G C PNP +P++ Sbjct: 96 HAIESFTAIPYKERGPCPPNPNMRPAY 122 >SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 27.1 bits (57), Expect = 8.0 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -2 Query: 213 SLISSRSLMRYSLTYCSALLKISLFFLMAEERLFSVTCNLLVRRASLLLRCLSTDS 46 SL SR+ M Y LK++L L+ ++ L S C+L R ++ +S D+ Sbjct: 142 SLAISRNQMELFGLYAGMRLKVALVGLIYKKILNSSRCSLSTVRTGHVINLISNDA 197 >SB_12133| Best HMM Match : DUF827 (HMM E-Value=0.64) Length = 325 Score = 27.1 bits (57), Expect = 8.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 98 LQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRG 238 L+ L+ R I+K AE+ +K R+KE D I + +RG Sbjct: 219 LRQALRERDRLIEKINSAVMSAEEQLKVRRLKEDDSIDQLSRHEHRG 265 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,710,671 Number of Sequences: 59808 Number of extensions: 286818 Number of successful extensions: 708 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -