BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30323 (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 28 0.068 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 26 0.36 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 26 0.36 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 3.4 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 4.5 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 28.3 bits (60), Expect = 0.068 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 1/106 (0%) Frame = -2 Query: 350 LYRCLSQFSLRIQPHVFDHKICFYGEACSLTRISGICKSFRRMLDEPFH*CNPASRGCYV 171 LY C S+F+ + Q ++ K+ +A +I +CK + + P H + + V Sbjct: 230 LYTCWSEFTQKTQGQIYGIKVDI-RDAYGNVKIPVLCKLIQSI---PTHLLDSEKKNFIV 285 Query: 170 KRRSPLFIKSLDKIRACGLDKTSKGFITN*SLCNCTCE-YLAVVAR 36 S F+ KI K + G + L C CE Y+A + R Sbjct: 286 DHISNQFVAFRRKIY-----KWNHGLLQGDPLSGCLCELYMAFMDR 326 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 25.8 bits (54), Expect = 0.36 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 411 NTKAVSPARSTCGEAIRTTPSERARSSNATPRN 509 NTK V + G T RA++ NATP N Sbjct: 296 NTKNVRRKTNPAGVTTTTKGKVRAKTQNATPAN 328 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 25.8 bits (54), Expect = 0.36 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 411 NTKAVSPARSTCGEAIRTTPSERARSSNATPRN 509 NTK V + G T RA++ NATP N Sbjct: 296 NTKNVRRKTNPAGVTTTTKGKVRAKTQNATPAN 328 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 205 WNGSSSIRRKLLQMPEMRVRLHAS 276 WN ++I + PE+R L AS Sbjct: 105 WNAGNAILAPIAASPELRANLIAS 128 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 224 FVGSFCKCPRCESGYTPL 277 F+ F CP CE+ T L Sbjct: 6 FIRKFVLCPECENPETEL 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,079 Number of Sequences: 336 Number of extensions: 3956 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -