BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30323 (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 26 1.1 AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 25 1.8 AY907825-1|AAX92637.1| 67|Anopheles gambiae antimicrobial pept... 24 4.2 AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 24 4.2 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 24 4.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.6 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 7.4 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 26.2 bits (55), Expect = 1.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 628 RTVHSTRLHSHLGPTLATHC 569 RTVH+ +HSH+ T++ HC Sbjct: 26 RTVHTLTIHSHM--TVSLHC 43 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 368 CSHPCRL-YRCLSQFSLRIQPHVFDHKIC 285 C HP + +R + F IQP +FD C Sbjct: 34 CRHPLLVDFRDIEGFDFIIQPKIFDAGFC 62 >AY907825-1|AAX92637.1| 67|Anopheles gambiae antimicrobial peptide defensin 3 protein. Length = 67 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 573 CVANVGPKWE*SLVLWTVRKGGRASLYCS 659 CV N GPKW + GR + C+ Sbjct: 29 CVTNEGPKWANTYCAAVCHMSGRGAGSCN 57 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -3 Query: 682 LISKAWV*EQYSEARPPFRTVHSTRLHSHLGP--TLATHCETYRG 554 LISK W E+ + P +H H+ T++T C+ G Sbjct: 33 LISKTWRAEKSDDPLYPLTIIHLNDFHARFEETNTVSTRCKPDEG 77 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -3 Query: 682 LISKAWV*EQYSEARPPFRTVHSTRLHSHLGP--TLATHCETYRG 554 LISK W E+ + P +H H+ T++T C+ G Sbjct: 33 LISKTWRAEKSDDPLYPLTIIHLNDFHARFEETNTVSTRCKPDEG 77 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 5.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 464 YTLGTGTQQQRNTPECSRISAAITYLLNRSASVSF 568 Y LG Q +PE + A TYLL + F Sbjct: 365 YLLGYRIMQLNTSPERKMVIAQNTYLLALDGDIDF 399 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 391 RPALHV*TRRRSAQRGLRVGKQFE 462 RP H TRR+S +RG + K ++ Sbjct: 519 RPVRHRPTRRKSTKRGKKDDKGYD 542 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,120 Number of Sequences: 2352 Number of extensions: 17280 Number of successful extensions: 61 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -