BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30323 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 3.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.9 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 9.1 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 9.1 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 377 EHAMLDRHYMYEHEGGQPSEVYVWGSNSNYTLGTGTQQQRNTPECSR 517 EH L + + E+E + E+ GS + + G++ + NT S+ Sbjct: 52 EHERLMKKMILEYELRRIREIEKLGSERSKSRSPGSRDRSNTSNTSK 98 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 94 KPLLVLSRPHARILSRLL 147 +P+LVLS P R+L +L Sbjct: 278 EPMLVLSGPRTRLLGSVL 295 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 564 VSQCVANVGPKWE*SLVLWTVRKGGRASLYC 656 V Q N P + L TV+KG A+L+C Sbjct: 799 VVQLKVNSSPYFAAPSRLVTVKKGDTATLHC 829 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 169 RGVRPSLSKALTKFEHVALIKLARASSLIDR 77 R RP LS+A + + +KL SSL R Sbjct: 1878 RSDRPELSEAECDIDSLKKLKLGLRSSLWSR 1908 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 94 KPLLVLSRPHARILSRLL 147 +P+LVLS P R+L +L Sbjct: 278 EPMLVLSGPRTRLLGSVL 295 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 564 VSQCVANVGPKWE*SLVLWTVRKGGRASLYC 656 V Q N P + L TV+KG A+L+C Sbjct: 795 VVQLKVNSSPYFAAPSRLVTVKKGDTATLHC 825 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 169 RGVRPSLSKALTKFEHVALIKLARASSLIDR 77 R RP LS+A + + +KL SSL R Sbjct: 1874 RSDRPELSEAECDIDSLKKLKLGLRSSLWSR 1904 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 171 EEAFAPLYQKP 139 EE + PLYQ+P Sbjct: 233 EEVYIPLYQQP 243 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 461 SNCFPTRRPRWADRL 417 SN TR P W DR+ Sbjct: 330 SNYMQTRVPAWCDRV 344 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,344 Number of Sequences: 438 Number of extensions: 4609 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -