BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30321X (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0068 - 27469929-27471050 28 4.4 01_06_1131 - 34762970-34763458,34765002-34765430 27 7.7 >05_07_0068 - 27469929-27471050 Length = 373 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 95 RTWNWVRRCFSGRCMSLGASATGHNLLLLYS 187 R + W+ R F C+ +GA +NLL YS Sbjct: 70 RPFTWLSRRFLAVCLVIGALMGANNLLFAYS 100 >01_06_1131 - 34762970-34763458,34765002-34765430 Length = 305 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 171 KLWPVAEAPNDMQRPEKHRRTQFQVRNMNSLKTK*VSR 58 K P+A P D R E+ ++ Q Q+ ++N L K V R Sbjct: 150 KAMPLALTPEDDPRKEELKKLQTQLEDINKLAHKQVRR 187 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,455,089 Number of Sequences: 37544 Number of extensions: 268916 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -