BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30321X (560 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_817| Best HMM Match : Peptidase_S28 (HMM E-Value=0) 31 0.85 SB_4294| Best HMM Match : DUF622 (HMM E-Value=7) 29 3.4 SB_38437| Best HMM Match : VWA (HMM E-Value=0) 28 6.0 SB_33336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_817| Best HMM Match : Peptidase_S28 (HMM E-Value=0) Length = 826 Score = 30.7 bits (66), Expect = 0.85 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = -1 Query: 149 LLTTCNVRRSTVEPSSKYGI*IRSKQNKFHDEGLILCILSM 27 LLTTC +++S + +YG+ + + +K H + L +++M Sbjct: 555 LLTTCVIKKSRDDIKRRYGLRVFGRGSKDHSKALATLVINM 595 >SB_4294| Best HMM Match : DUF622 (HMM E-Value=7) Length = 360 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 92 FRTWNWVRRCFSGRCMSLGASATG 163 FR W + R F+ RC+S G SA G Sbjct: 51 FREWEQIAREFNKRCISDGVSALG 74 >SB_38437| Best HMM Match : VWA (HMM E-Value=0) Length = 3445 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 32 TKYTVLSLRRETYFVLSEFIFRTWNWVRRCFSGR 133 T T+L+ Y F +R WN+V ++GR Sbjct: 3130 TSVTILARVASKYITSKAFRYRAWNYVGTTYNGR 3163 >SB_33336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 186 EYNNNKLWPVAEAPNDMQRPEKHRRTQFQVRNMNSLK 76 E+ N KL+P+A+AP + K ++ ++N K Sbjct: 123 EHENEKLFPLADAPGEATGGLKSEHNSLEIPSVNVTK 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,286,804 Number of Sequences: 59808 Number of extensions: 340764 Number of successful extensions: 676 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -