BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30321X (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 25 2.2 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 24 3.0 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 6.8 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 247 TTKRAALSDVRLLNNNPCAKCDFFNILDS 333 TT+ + + R + +NP K FF +DS Sbjct: 14 TTREQMVQEFRKVRDNPQPKAVFFTCMDS 42 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 24.2 bits (50), Expect = 3.0 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 396 ANLPPLRQQMLKKFAGYYNFYAIENVKKIALSTRI-IVQQTNVAEGR 259 ANL + ++ F + + +A+E +AL TR+ ++ T+ EG+ Sbjct: 182 ANLRDEKNELPADFNEWLSRWALETTGVLALDTRLGVLHSTDSGEGQ 228 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 6.8 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 460 NPHMYLFIYLLEHPQKNRVIIVII 531 N H+ L YLL+H K+ ++++ + Sbjct: 1062 NRHLNLREYLLQHSSKSDLVVMTL 1085 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,233 Number of Sequences: 2352 Number of extensions: 12814 Number of successful extensions: 63 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -