BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30321X (560 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 29 2.1 At2g41510.1 68415.m05129 FAD-binding domain-containing protein /... 27 6.5 At1g06140.1 68414.m00645 pentatricopeptide (PPR) repeat-containi... 27 6.5 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 27 6.5 At5g67220.1 68418.m08473 nitrogen regulation family protein simi... 27 8.6 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 402 PCANLPPLRQQMLKKFAGYYNFYAI 328 PC + P+ Q+ K FAG + FY I Sbjct: 118 PCRMIHPIVDQLAKDFAGKFKFYKI 142 >At2g41510.1 68415.m05129 FAD-binding domain-containing protein / cytokinin oxidase family protein similar to cytokinin oxidase, Zea mays [gi:3882018] [gi:3441978] Length = 575 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 2 LTYPSNRNAWTKYTVLSLRRETYFVLSEFI 91 L YP N++ W K+T L E F L F+ Sbjct: 432 LIYPVNQSKWKKHTSLITPNEDIFYLVAFL 461 >At1g06140.1 68414.m00645 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 558 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 217 SYTAQISDFLTTKRAALSDVRLLNN---NPCAKCDFFNILDSVKVIIAGKLLEH 369 S+ +S + +K SDV LL N C D FN++ ++K + LLE+ Sbjct: 74 SWNTILSGYSKSKTCCYSDVLLLYNRMRRHCDGVDSFNLVFAIKACVGLGLLEN 127 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 27.5 bits (58), Expect = 6.5 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -3 Query: 402 PCANLPPLRQQMLKKFAGYYNFYAI 328 PC + P+ ++ +K+AG + FY + Sbjct: 106 PCKMIDPIVNELAQKYAGQFKFYKL 130 >At5g67220.1 68418.m08473 nitrogen regulation family protein similar to unknown protein (gb|AAF51525.1) ; contains Pfam domain PF01207: Dihydrouridine synthase (Dus); similar to (SP:P45672) NIFR3-like protein (SP:P45672) [Azospirillum brasilense] Length = 423 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 241 FLTTKRAALSDVRLLNNNPCAKCDFFNILDSV 336 FL T+++ +S R + NP K D +LD + Sbjct: 10 FLRTRKSLISQTRAMTQNPDPKPDPSQVLDDI 41 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,973,267 Number of Sequences: 28952 Number of extensions: 230929 Number of successful extensions: 580 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -