BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30320 (612 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 157 1e-40 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 157 1e-40 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 9.5 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 9.5 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 9.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 9.5 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 9.5 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 9.5 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 9.5 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 9.5 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.5 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 9.5 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 157 bits (380), Expect = 1e-40 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 435 G++AA+SKT VAPIERVKLLLQVQH+SKQI+ +QRYKG++D FVRIPKEQG LS+WRGN Sbjct: 18 GVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNL 77 Query: 436 ANVIRYFPTQALNFAFKDKYKQVF 507 ANVIRYFPTQALNFAFKDKYKQVF Sbjct: 78 ANVIRYFPTQALNFAFKDKYKQVF 101 Score = 33.5 bits (73), Expect = 0.002 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 206 MSNLADPVAFAKDFLA 253 MS LADPVAFAKDFLA Sbjct: 1 MSGLADPVAFAKDFLA 16 Score = 27.5 bits (58), Expect = 0.11 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 450 P + V+ + +Q S + ++ YK + + I K +G +F++G F+N++R Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEILYKSTLHCWATIYKTEGGNAFFKGAFSNILR 282 Score = 27.1 bits (57), Expect = 0.14 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 519 DKKTQFWRYFXXXXXXXXXXXXTSLCLCTP 608 DK TQF RYF TSLC P Sbjct: 106 DKNTQFLRYFVGNLASGGAAGATSLCFVYP 135 Score = 26.2 bits (55), Expect = 0.25 Identities = 20/85 (23%), Positives = 36/85 (42%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 435 G + A S V P++ + L V K ++ + G+ + +I K G+ +RG Sbjct: 123 GAAGATSLCFVYPLDFARTRLAAD-VGKA-GGEREFTGLGNCLTKIFKADGITGLYRGFG 180 Query: 436 ANVIRYFPTQALNFAFKDKYKQVFP 510 +V +A F F D + + P Sbjct: 181 VSVQGIIIYRAAYFGFYDTARGMLP 205 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 157 bits (380), Expect = 1e-40 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 435 G++AA+SKT VAPIERVKLLLQVQH+SKQI+ +QRYKG++D FVRIPKEQG LS+WRGN Sbjct: 18 GVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNL 77 Query: 436 ANVIRYFPTQALNFAFKDKYKQVF 507 ANVIRYFPTQALNFAFKDKYKQVF Sbjct: 78 ANVIRYFPTQALNFAFKDKYKQVF 101 Score = 33.5 bits (73), Expect = 0.002 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 206 MSNLADPVAFAKDFLA 253 MS LADPVAFAKDFLA Sbjct: 1 MSGLADPVAFAKDFLA 16 Score = 27.5 bits (58), Expect = 0.11 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 450 P + V+ + +Q S + ++ YK + + I K +G +F++G F+N++R Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEILYKSTLHCWATIYKTEGGNAFFKGAFSNILR 282 Score = 27.1 bits (57), Expect = 0.14 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 519 DKKTQFWRYFXXXXXXXXXXXXTSLCLCTP 608 DK TQF RYF TSLC P Sbjct: 106 DKNTQFLRYFVGNLASGGAAGATSLCFVYP 135 Score = 26.2 bits (55), Expect = 0.25 Identities = 20/85 (23%), Positives = 36/85 (42%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 435 G + A S V P++ + L V K ++ + G+ + +I K G+ +RG Sbjct: 123 GAAGATSLCFVYPLDFARTRLAAD-VGKA-GGEREFTGLGNCLTKIFKADGITGLYRGFG 180 Query: 436 ANVIRYFPTQALNFAFKDKYKQVFP 510 +V +A F F D + + P Sbjct: 181 VSVQGIIIYRAAYFGFYDTARGMLP 205 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K Y EKLL R Y RS R S Sbjct: 21 KLYNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSREREQNS 49 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 243 KLHNEKEKLLEERTSRKRYSRSREREQNS 271 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 243 KLHNEKEKLLEERTSRKRYSRSREREQNS 271 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 254 KLHNEKEKLLEERTSRKRYSRSREREQNS 282 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 609 KGYTSTEKLLRRHHRRPDYQRSNARTASS 523 K + EKLL R Y RS R +S Sbjct: 254 KLHNEKEKLLEERTSRKRYSRSREREQNS 282 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 131 VIPHPRVPQLPPRHIHLVKIT 193 +I P +LPP H H +T Sbjct: 92 IITIPPTRKLPPLHPHTAMVT 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,064 Number of Sequences: 438 Number of extensions: 3349 Number of successful extensions: 62 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -