BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30317 (745 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19257| Best HMM Match : No HMM Matches (HMM E-Value=.) 196 2e-50 SB_42692| Best HMM Match : Ribosomal_L2_C (HMM E-Value=4.9e-05) 137 1e-32 SB_43058| Best HMM Match : Ribosomal_L2_C (HMM E-Value=8.26766e-44) 38 0.009 SB_39055| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13) 31 1.3 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 29 3.0 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_19257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 196 bits (478), Expect = 2e-50 Identities = 96/161 (59%), Positives = 113/161 (70%) Frame = +2 Query: 263 YTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEETMGDRGRLARASGNFATVIGHNPD 442 YTGQF+YCGKKA L++GN +PVG MPEGTI+ ++EE GDRGRLAR SGN+ATVI HN + Sbjct: 83 YTGQFIYCGKKAALQIGNCLPVGIMPEGTIISSVEEKTGDRGRLARTSGNYATVISHNVE 142 Query: 443 AKRTRVKLPSGAKKVLPSSNRGWSVLLLEVDVLTNLF*KLEGHTTSTRSNVTAGHMYVVL 622 KRTRVKLPSG KKV+PSSNR ++ + K ++ + Sbjct: 143 KKRTRVKLPSGIKKVIPSSNRALVGIVAGGGRIDKPMLKAGRAYHKYKAKRNCWPRVRGV 202 Query: 623 PMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRT 745 MNPVEHPHGGGNHQHIG STV+R T AGRKVGLIAARRT Sbjct: 203 AMNPVEHPHGGGNHQHIGHPSTVRRDTPAGRKVGLIAARRT 243 Score = 141 bits (341), Expect = 6e-34 Identities = 64/83 (77%), Positives = 72/83 (86%) Frame = +1 Query: 19 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLDYAERHGYIKGVVKDIIHDPGRGAPLAV 198 MGRVIR QRKGAGS+F SHTK RKGA LR DYAERHGYIKGVVK+IIHDPGRGAPLAV Sbjct: 1 MGRVIRGQRKGAGSIFTSHTKHRKGAANLRVHDYAERHGYIKGVVKEIIHDPGRGAPLAV 60 Query: 199 VHFRDPYKFKTRKELFIAPKALH 267 V FRDPY++K RKELF+A + ++ Sbjct: 61 VVFRDPYRYKLRKELFVATEGMY 83 Score = 85.0 bits (201), Expect = 6e-17 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +1 Query: 508 LVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAHEP 633 LVGIVAGGGRIDKP+LKAGRAYHKYK KRNCWP VRGVA P Sbjct: 165 LVGIVAGGGRIDKPMLKAGRAYHKYKAKRNCWPRVRGVAMNP 206 >SB_42692| Best HMM Match : Ribosomal_L2_C (HMM E-Value=4.9e-05) Length = 123 Score = 137 bits (331), Expect = 1e-32 Identities = 60/81 (74%), Positives = 70/81 (86%) Frame = +2 Query: 263 YTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEETMGDRGRLARASGNFATVIGHNPD 442 YTGQF+YCGKKA L++GN +PVG MPEGTI+ ++EE GDRGRLAR SGN+ATVI HN + Sbjct: 41 YTGQFIYCGKKAALQIGNCLPVGIMPEGTIISSVEEKTGDRGRLARTSGNYATVISHNVE 100 Query: 443 AKRTRVKLPSGAKKVLPSSNR 505 KRTRVKLPSG KKV+PSSNR Sbjct: 101 KKRTRVKLPSGIKKVIPSSNR 121 Score = 71.3 bits (167), Expect = 8e-13 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 145 GVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPKALH 267 GVVK+IIHDPGRGAPLAVV FRDPY++K RKELF+A + ++ Sbjct: 1 GVVKEIIHDPGRGAPLAVVVFRDPYRYKLRKELFVATEGMY 41 >SB_43058| Best HMM Match : Ribosomal_L2_C (HMM E-Value=8.26766e-44) Length = 222 Score = 37.9 bits (84), Expect = 0.009 Identities = 24/67 (35%), Positives = 37/67 (55%) Frame = +2 Query: 296 ATLEVGNVMPVGAMPEGTIVCNLEETMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSG 475 A L+ G+ P+ +P GT+V N+E G +LARA+G A +I + V+LPS Sbjct: 110 ALLKPGDAYPLCFLPIGTVVHNIELYPGKGAQLARAAGTSAQLIRKTNET--AVVRLPSK 167 Query: 476 AKKVLPS 496 +K + S Sbjct: 168 VEKEVSS 174 >SB_39055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 448 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = -1 Query: 451 TLSIRIVSNHSGEVSRGTCQTTSITHCFFKIAHNG--TLRHSSNRHHISNFKSCFLSTIN 278 T SI ++ + + + GTC+ + FFK+ H + H + H ++N C + ++ Sbjct: 76 THSILVLLSAAACAANGTCEEPRRRNTFFKLKHKDRMLIDHVISSHDVTNPIHCSMECLS 135 Query: 277 KLACV 263 CV Sbjct: 136 NQRCV 140 >SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13) Length = 1819 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -2 Query: 591 FDLVLVVCPSSFQNRFVNT--STSSNNTDQPLLLDGRTFLAPDGSFT 457 F L V PSS QN F + + ++ T L+LD TFL PDGS T Sbjct: 114 FSLNCDVIPSS-QNAFQSFEFNPAATTTYLNLILDSETFLEPDGSAT 159 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = +2 Query: 488 LPSSNRGWSVLLLEVDVLTNLF*KLEGHTTSTRSNVTAGHMYVVLPMNPVEHPHGGGNHQ 667 L N+G+ LL +D T + + T TRS +TA + P H HQ Sbjct: 186 LSKFNKGYKFLLTCIDKFTKVAWAVP-LKTKTRSEITAAFKMIFKSQKPRIHQTDKNTHQ 244 Query: 668 HIG 676 ++G Sbjct: 245 YLG 247 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 311 GNVMPVGAMPEGTIVCNLEETMGDRGRLAR-ASGNFATVIG 430 G+ PV +P G +C + +G R AR G F ++ G Sbjct: 737 GHSKPVDGLPRGDAICGCPKAIGRRHARARLLEGRFLSISG 777 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,963,180 Number of Sequences: 59808 Number of extensions: 570396 Number of successful extensions: 1417 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1408 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -