BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30317 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 25 0.75 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 23 4.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.0 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 25.0 bits (52), Expect = 0.75 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 425 IGHNPDAKRTRVKLPSGAKKVLPSSNRGWSVLLLE 529 IG+ + K+TR LP+G +KVL + + VL+++ Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVLVHNVKELEVLMMQ 90 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 183 CTFGCCTLPRSIQVQDKEGALHCSEGSTQANLFI 284 C FG + S V + + H +GS +A F+ Sbjct: 174 CIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFV 207 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 550 ILKAGRAYHKYKVKRNCWPYVRGVAHEPCRASSRWW 657 I++A AY + ++ R PY+R A R+W Sbjct: 1162 IVQAENAYPEVELDRELRPYLRTAAAILTWNEKRFW 1197 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,664 Number of Sequences: 438 Number of extensions: 4991 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -