BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30316X (339 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 37 7e-04 SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 37 7e-04 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 36 0.002 SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosacch... 27 0.78 SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A... 27 0.78 SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B sub... 27 0.78 SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2... 27 0.78 SPAC637.13c |||cytoskeletal signaling protein|Schizosaccharomyce... 25 4.2 SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 24 5.5 SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylg... 24 7.3 SPBC2A9.02 |||NAD dependent epimerase/dehydratase family protein... 23 9.6 SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S... 23 9.6 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 37.1 bits (82), Expect = 7e-04 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 +DV+P W +FAK LEG + ++L+ NIG Sbjct: 36 VDVEPIWATIFAKALEGKDLKELLLNIG 63 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 37.1 bits (82), Expect = 7e-04 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 +DV+P W +FAK LEG + ++L+ NIG Sbjct: 36 VDVEPIWATIFAKALEGKDLKELLLNIG 63 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 35.5 bits (78), Expect = 0.002 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 ++V+P W +FAK LEG + ++L+ NIG Sbjct: 36 VEVEPIWATIFAKALEGKDLKELLLNIG 63 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosaccharomyces pombe|chr 3|||Manual Length = 312 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 302 SDEDMGFGLFD 312 >SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2C subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 110 Score = 27.1 bits (57), Expect = 0.78 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC637.13c |||cytoskeletal signaling protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 24.6 bits (51), Expect = 4.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 246 PLQADVGDQVTGIDAFQGFC 305 P QA GD V DA+ G C Sbjct: 16 PNQASNGDAVPNTDAYMGLC 35 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 24.2 bits (50), Expect = 5.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 289 PSKGFANRPGQYGS 330 PSKGF NRP ++ S Sbjct: 314 PSKGFHNRPKKFAS 327 >SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylglycerol ethanolaminesphotranferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 386 Score = 23.8 bits (49), Expect = 7.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 326 PYWPGLFAKPLEGINARDLITNIGLEWVLLRPL 228 PYW K + A +LIT IGL +V++ L Sbjct: 31 PYWWNQLLKVIPMSMAPNLITLIGLGFVVINIL 63 >SPBC2A9.02 |||NAD dependent epimerase/dehydratase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 295 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 272 GHGH*CLPRVLRTDLANM 325 G+G C P V RTD AN+ Sbjct: 186 GNGMNCWPAVHRTDAANL 203 >SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|Schizosaccharomyces pombe|chr 3|||Manual Length = 624 Score = 23.4 bits (48), Expect = 9.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 287 INARDLITNIGLEWVL 240 +N RD++TN EW++ Sbjct: 208 LNERDILTNTNSEWLV 223 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 859,592 Number of Sequences: 5004 Number of extensions: 8439 Number of successful extensions: 33 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 98026656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -