BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30316X (339 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal pro... 45 2e-05 U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal prote... 41 2e-04 Z79754-9|CAB02098.1| 312|Caenorhabditis elegans Hypothetical pr... 29 1.1 U97194-7|AAB52450.2| 107|Caenorhabditis elegans Hypothetical pr... 29 1.1 AL132865-1|CAB60595.1| 110|Caenorhabditis elegans Hypothetical ... 29 1.1 AC024882-3|AAF60934.1| 340|Caenorhabditis elegans Seven tm rece... 27 4.5 >AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal protein, acidic protein 1 protein. Length = 111 Score = 44.8 bits (101), Expect = 2e-05 Identities = 15/27 (55%), Positives = 24/27 (88%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNI 258 ++ +PYWPGLFAK LEG++ ++LIT++ Sbjct: 37 VEFEPYWPGLFAKALEGVDVKNLITSV 63 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SDDDMGFGLFD Sbjct: 101 SDDDMGFGLFD 111 >U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal protein P1 homolog protein. Length = 111 Score = 41.1 bits (92), Expect = 2e-04 Identities = 14/27 (51%), Positives = 23/27 (85%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNI 258 ++ +P WPGLFAK LEG++ ++LIT++ Sbjct: 37 VEFEPNWPGLFAKALEGVDVKNLITSV 63 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SDDDMGFGLFD Sbjct: 101 SDDDMGFGLFD 111 >Z79754-9|CAB02098.1| 312|Caenorhabditis elegans Hypothetical protein F25H2.10 protein. Length = 312 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SDDDMGFGLFD Sbjct: 302 SDDDMGFGLFD 312 >U97194-7|AAB52450.2| 107|Caenorhabditis elegans Hypothetical protein C37A2.7 protein. Length = 107 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SDDDMGFGLFD Sbjct: 97 SDDDMGFGLFD 107 >AL132865-1|CAB60595.1| 110|Caenorhabditis elegans Hypothetical protein Y62E10A.1 protein. Length = 110 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 144 SDDDMGFGLFD 112 SDDDMGFGLFD Sbjct: 100 SDDDMGFGLFD 110 >AC024882-3|AAF60934.1| 340|Caenorhabditis elegans Seven tm receptor protein 155 protein. Length = 340 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/36 (30%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -2 Query: 323 YWPGLFAKPLEG---INARDLITNIGLEWVLLRPLV 225 YW L+ +P +G + A+D++ N+GL ++ P++ Sbjct: 182 YWVFLYWQPKDGNQDLTAKDIMANLGLTTSMVIPIL 217 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,762,828 Number of Sequences: 27780 Number of extensions: 47580 Number of successful extensions: 83 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 429601520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -