BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30316X (339 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24510.1 68418.m02889 60s acidic ribosomal protein P1, putative 36 0.005 At4g00810.2 68417.m00112 60S acidic ribosomal protein P1 (RPP1B)... 36 0.005 At4g00810.1 68417.m00111 60S acidic ribosomal protein P1 (RPP1B)... 36 0.005 At1g01100.2 68414.m00013 60S acidic ribosomal protein P1 (RPP1A)... 36 0.009 At1g01100.1 68414.m00012 60S acidic ribosomal protein P1 (RPP1A)... 36 0.009 At5g47700.1 68418.m05889 60S acidic ribosomal protein P1 (RPP1C) 35 0.012 At1g79330.1 68414.m09245 latex-abundant protein, putative (AMC6)... 29 0.60 At5g50100.1 68418.m06204 expressed protein contains Pfam domain ... 27 4.2 At1g79320.1 68414.m09244 latex abundant protein, putative (AMC5)... 26 5.6 At1g11000.1 68414.m01263 seven transmembrane MLO family protein ... 26 7.4 >At5g24510.1 68418.m02889 60s acidic ribosomal protein P1, putative Length = 111 Score = 36.3 bits (80), Expect = 0.005 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 ++V+ YWP LFAK E N DLI N+G Sbjct: 36 VNVESYWPSLFAKLCEKKNIDDLIMNVG 63 >At4g00810.2 68417.m00112 60S acidic ribosomal protein P1 (RPP1B) similar to acidic ribosomal protein p1 Length = 113 Score = 36.3 bits (80), Expect = 0.005 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 ++++ YWP LFAK E N DLI N+G Sbjct: 37 VEIESYWPMLFAKMAEKRNVTDLIMNVG 64 >At4g00810.1 68417.m00111 60S acidic ribosomal protein P1 (RPP1B) similar to acidic ribosomal protein p1 Length = 113 Score = 36.3 bits (80), Expect = 0.005 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 ++++ YWP LFAK E N DLI N+G Sbjct: 37 VEIESYWPMLFAKMAEKRNVTDLIMNVG 64 >At1g01100.2 68414.m00013 60S acidic ribosomal protein P1 (RPP1A) similar to 60S ACIDIC RIBOSOMAL PROTEIN P1 GB:O23095 from [Arabidopsis thaliana] Length = 112 Score = 35.5 bits (78), Expect = 0.009 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 + ++ YWP LFAK E N DLI N+G Sbjct: 37 VSIESYWPMLFAKMAEKRNVTDLIMNVG 64 >At1g01100.1 68414.m00012 60S acidic ribosomal protein P1 (RPP1A) similar to 60S ACIDIC RIBOSOMAL PROTEIN P1 GB:O23095 from [Arabidopsis thaliana] Length = 112 Score = 35.5 bits (78), Expect = 0.009 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 + ++ YWP LFAK E N DLI N+G Sbjct: 37 VSIESYWPMLFAKMAEKRNVTDLIMNVG 64 >At5g47700.1 68418.m05889 60S acidic ribosomal protein P1 (RPP1C) Length = 113 Score = 35.1 bits (77), Expect = 0.012 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 338 IDVDPYWPGLFAKPLEGINARDLITNIG 255 + ++ YWP LFAK E N DLI N+G Sbjct: 37 VTIESYWPMLFAKMAEKRNVTDLIMNVG 64 >At1g79330.1 68414.m09245 latex-abundant protein, putative (AMC6) / caspase family protein similar to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam domain, PF00656: ICE-like protease (caspase) p20 domain Length = 410 Score = 29.5 bits (63), Expect = 0.60 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 262 LVIRSRALMPSKGFANRPGQYGSTS 336 LV+++R L+ +GF+ RPG Y S S Sbjct: 378 LVLKARKLLKKQGFSQRPGLYCSDS 402 >At5g50100.1 68418.m06204 expressed protein contains Pfam domain PF04134: Protein of unknown function, DUF393 Length = 214 Score = 26.6 bits (56), Expect = 4.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 243 HPLQADVGDQVTGIDAFQGFCEQTWPIWVY 332 H +Q+D G+ V G++AF+ E+ WVY Sbjct: 131 HAIQSD-GNVVKGVEAFRRLYEEVGLGWVY 159 >At1g79320.1 68414.m09244 latex abundant protein, putative (AMC5) / caspase family protein similar to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam domain, PF00656: ICE-like protease (caspase) p20 domain Length = 368 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 262 LVIRSRALMPSKGFANRPGQY 324 LV+++R L+ +GF RPG Y Sbjct: 336 LVLKARKLLRKQGFDQRPGLY 356 >At1g11000.1 68414.m01263 seven transmembrane MLO family protein / MLO-like protein 4 (MLO4) identical to membrane protein Mlo4 [Arabidopsis thaliana] gi|14091578|gb|AAK53797; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 573 Score = 25.8 bits (54), Expect = 7.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 285 DAFQGFCEQTWPIWVY 332 D F G +WP+WVY Sbjct: 270 DEFHGIVGISWPLWVY 285 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,511,534 Number of Sequences: 28952 Number of extensions: 44866 Number of successful extensions: 128 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 399440640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -