BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30315 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11216| Best HMM Match : GILT (HMM E-Value=6.7e-10) 41 0.001 SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) 31 1.2 SB_41275| Best HMM Match : Lig_chan (HMM E-Value=2.3e-11) 31 1.2 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 29 2.7 SB_25297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_21866| Best HMM Match : UCH (HMM E-Value=0) 29 4.7 SB_13201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) 28 6.2 SB_1245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_54785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 44.4 bits (100), Expect = 9e-05 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 261 VKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVL 377 + +VPYG + + KW F C HG EC GN ++ C + Sbjct: 61 ITLVPYGNAQEYRYGNKWVFNCQHGQGECEGNIIEVCAI 99 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/56 (35%), Positives = 35/56 (62%) Frame = +2 Query: 506 ERCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKYDKDVETQAFENLKAVVC 673 E+CAS QG+ L G +TDA++ +VP V +N ++ ++++ QA N+ +VC Sbjct: 143 EKCASGLQGNELEHEMGVETDALVPRHNYVPWVTLNGEHTEEIQNQATFNMLGLVC 198 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 160 VKIAVYYESLCPDSKKFITTQLAPVWRDFRGLSKSKWSRMGRARTTRWMGN 312 V I++YYES+C + I QL P ++ + G A+ R+ GN Sbjct: 27 VAISLYYESMCGGCRDMIRDQLYPTFQKVGSIMDITLVPYGNAQEYRY-GN 76 >SB_11216| Best HMM Match : GILT (HMM E-Value=6.7e-10) Length = 311 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = +3 Query: 261 VKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQT 440 + MVP+G K + + C +GA+EC N +QAC + N + + Sbjct: 62 ISMVPFGDGKEIKAKSGFQYYCTNGAEECLENLIQACAVATENNPEILTSFVGCLSYYDG 121 Query: 441 SPDKSLDTCLTQV 479 S DK C Q+ Sbjct: 122 SVDKIAKYCSNQI 134 Score = 35.5 bits (78), Expect = 0.041 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +2 Query: 506 ERCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKYDKDVETQAFENLKAVVCRV 679 E C + QG ++ KT + ++ P + +N ++ + ++ QA ENL +VC V Sbjct: 141 EYCLKNTQGLEVMHYMAKKTRGLQPKMSHSPWITVNGEHSEFIQQQAMENLLQLVCTV 198 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 136 KKKTEDHKVKIAVYYESLCPDSKKFITTQLAP 231 K+ + KVK+AVYY S P+ ++F+ QL P Sbjct: 20 KQTKKAEKVKLAVYYNSKNPEFRRFMVAQLYP 51 >SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) Length = 1421 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 346 HSSAPWWQMNDHFPSTLS 293 HS+ +W NDHFPS+LS Sbjct: 585 HSNHRYWYYNDHFPSSLS 602 >SB_41275| Best HMM Match : Lig_chan (HMM E-Value=2.3e-11) Length = 1171 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -3 Query: 570 ASVLSPYDASRLSPCSLDAHLSVYPTPT 487 AS+ SPY SRL+P L A L YP P+ Sbjct: 992 ASLTSPYTFSRLAPPRLTAPLGHYPHPS 1019 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/71 (25%), Positives = 28/71 (39%) Frame = +3 Query: 417 VICLMNQTSPDKSLDTCLTQVDKMSESDKLKDAHPVNKETICSRRTVIKRML**DLSRSC 596 V+ +N+ D SL + P E +C+ R + + SRSC Sbjct: 383 VVLKINKKEVDASLTQHKLPIRTQQNEITYNVTDPAGNENLCNFRVRVNDVEPPTCSRSC 442 Query: 597 PPLLLTRNTTK 629 PP ++ TTK Sbjct: 443 PPDIIKELTTK 453 >SB_25297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -2 Query: 517 CASFSLSDSDILST*VKHVSKDLSGLVWFMRHITISIFSV 398 C+ L S ++ V +++ +SG++WF+R + + + V Sbjct: 288 CSLMLLHTSHLMDNEVSPITRLVSGILWFLRMVVLGVTKV 327 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%) Frame = +3 Query: 294 DKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVI-CLMNQTSPD---KSLD 461 ++ D KW HG DE +Q C L +R + + + EI + ++ P+ SLD Sbjct: 4004 EEQDNKWELFIKHGTDE-NPLHIQLCFLINRLIGNHVEKEIYLQAMLACRVPEDILPSLD 4062 Query: 462 TCLTQVDKMSESDKLKD 512 C D +S + D Sbjct: 4063 RCGVAQDLLSSDKRTTD 4079 >SB_21866| Best HMM Match : UCH (HMM E-Value=0) Length = 2165 Score = 28.7 bits (61), Expect = 4.7 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +3 Query: 198 QQEVYNDATGSRLEGLQRTVKV-KMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACV 374 ++E N+A L + + KV V Y H D + A+ + NKV + V Sbjct: 223 KKEAKNEAKNDALSSIIKINKVISSVSYYTHRHTTADEEEWLTAERMAEWIHANKVLSIV 282 Query: 375 LKD--RNLQDTEKMEIVI 422 LKD Q EK+E +I Sbjct: 283 LKDNLHQPQYVEKLEKII 300 >SB_13201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 33 FQKNHIIVFFPDIKQQDEDSPAGLLSDAALLCRGEEENRRP 155 F++ + VFF D+ + E +++ LL G E +RRP Sbjct: 10 FRRRSVTVFFDDLLSESERQSGDNITNNELLPVGYERDRRP 50 >SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = -2 Query: 574 HSIRFITVRREQIVSLFTGCASFSLSDSDILST*VKHVSKDLSGLVWFMRHITISIFSVS 395 H I V + SLF G + + D S VK L L + RH+ IS++ ++ Sbjct: 362 HEAGQIDVLLRFVSSLFEGTNTLIILDDCAASKDVKRRFDQLVNLAFSARHVDISVWVIT 421 Query: 394 WRLRS 380 +L S Sbjct: 422 QQLTS 426 >SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) Length = 942 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 401 GEDGDCNMPHEPDQPRQV 454 GE+G+C EP+ PRQ+ Sbjct: 173 GENGECQYSREPEPPRQI 190 >SB_1245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 359 GASLRPEGPQPPGHGEDGDCNMPHEPDQPRQVFGHVLNSSGQDVGV 496 G SL P +GD +P D PR++ H+L + D G+ Sbjct: 11 GRSLNPAIDVGQSRAAEGDYKIPSLRDIPREMNVHILKNMRNDKGI 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,635,121 Number of Sequences: 59808 Number of extensions: 543323 Number of successful extensions: 1505 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1499 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -