BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30315 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 28 0.24 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.9 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 24 3.9 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 3.9 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 5.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.0 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 28.3 bits (60), Expect = 0.24 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +3 Query: 234 LEGLQRTVKVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQ 395 LEG ++ ++ KM+PY + K + +I H D + ++ C L ++++Q Sbjct: 134 LEGYRKILRRKMLPYAR---QKFGDEEHYIFQHDNDSKHTSRTVKCYLANQDVQ 184 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.2 bits (50), Expect = 3.9 Identities = 15/59 (25%), Positives = 19/59 (32%) Frame = +2 Query: 380 GPQPPGHGEDGDCNMPHEPDQPRQVFGHVLNSSGQDVGVG*TERCASSEQGDNLLASYG 556 GP P G G C+ P + +SS T C + G AS G Sbjct: 767 GPPPDGSGSGSRCSKPSVTSTTPPTPASLSSSSSSSSSASSTSLCGGNGGGGGAGASGG 825 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 527 QGDNLLASYGDKTDAVMRPLAFVPTV 604 +G+NLLA G +AVMR +P+V Sbjct: 190 EGNNLLAPEGGLHEAVMRGGFLLPSV 215 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 3.9 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = -3 Query: 372 RKLAPCCRSTRQRR---GGR*MTISHPPCRACSSHTGP 268 RK+ P R+ R+R GGR + PP R S T P Sbjct: 248 RKIPPSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTRP 285 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 418 TISIFSVSWRLRSF 377 T+S+FSV W L SF Sbjct: 319 TLSLFSVCWALASF 332 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 597 GTNARGLITASVLSPYDASRLSPCSLDAH 511 G+ RGL+ A V S +P SL AH Sbjct: 134 GSELRGLVAAQVAGITFISVYAPPSLSAH 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 771,560 Number of Sequences: 2352 Number of extensions: 17310 Number of successful extensions: 46 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -