BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30315 (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12870.1 68417.m02015 gamma interferon responsive lysosomal t... 40 0.001 At4g12900.1 68417.m02018 gamma interferon responsive lysosomal t... 38 0.005 At2g44580.1 68415.m05548 zinc finger (C3HC4-type RING finger) fa... 38 0.008 At4g12960.1 68417.m02025 gamma interferon responsive lysosomal t... 36 0.033 At1g07080.1 68414.m00754 gamma interferon responsive lysosomal t... 35 0.044 At4g12890.1 68417.m02017 gamma interferon responsive lysosomal t... 34 0.10 At5g01580.1 68418.m00073 gamma interferon responsive lysosomal t... 33 0.18 At4g21020.1 68417.m03041 late embryogenesis abundant domain-cont... 30 1.3 At1g56510.1 68414.m06498 disease resistance protein (TIR-NBS-LRR... 30 1.3 At4g38350.1 68417.m05422 patched family protein similar to SP|O1... 30 1.7 At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PG... 30 1.7 At1g42470.1 68414.m04897 patched family protein similar to SP|O1... 29 2.2 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 29 2.2 At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DN... 28 5.0 At3g18290.1 68416.m02326 zinc finger protein-related weak alignm... 28 5.0 At5g39440.1 68418.m04777 Snf1-related protein kinase, putative s... 28 6.7 At4g37060.1 68417.m05248 patatin, putative similar to patatin-li... 28 6.7 At1g06490.1 68414.m00688 glycosyl transferase family 48 protein ... 28 6.7 At5g51750.1 68418.m06417 subtilase family protein similar to sub... 27 8.8 At4g00416.1 68417.m00056 methyl-CpG-binding domain-containing pr... 27 8.8 >At4g12870.1 68417.m02015 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 229 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +3 Query: 243 LQRTVKVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVI 422 L VK+VP+G + KV + IC HG +EC N ++ACV+ + + + Sbjct: 62 LDTITDVKLVPFG---YAKVSNNLTVICQHGEEECKLNALEACVINTLP-NPKSQYKFIR 117 Query: 423 CLMNQTSPDKSLDTCL 470 C+ N T D +CL Sbjct: 118 CVENNT--DNWESSCL 131 Score = 36.3 bits (80), Expect = 0.019 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +1 Query: 94 RLVCFLMLLCYVVAKKKT--EDHKVKIAVYYESLCPDSKKFITTQLAPVW 237 +LV F + + + K E KV++ +YYESLCP + FI +L V+ Sbjct: 9 KLVFFACFVLFTFSHKLVTGESDKVELNLYYESLCPGCQSFIVDELVKVF 58 >At4g12900.1 68417.m02018 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 231 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = +1 Query: 94 RLVCFLMLLCYVVAKKKT---EDHKVKIAVYYESLCPDSKKFITTQLAPVWR-DFRGLSK 261 +LV F LL + + E KVK+ +YYESLCP + FI L ++ D ++ Sbjct: 12 KLVFFACLLLFTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLGKIFNTDLHTITD 71 Query: 262 SKWSRMGRARTT 297 K G A + Sbjct: 72 LKLIPFGNAHVS 83 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +3 Query: 243 LQRTVKVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLK 380 L +K++P+G + V + C HG +EC N ++AC ++ Sbjct: 66 LHTITDLKLIPFGNA---HVSDDLTVTCQHGEEECKLNALEACAIR 108 >At2g44580.1 68415.m05548 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 624 Score = 37.5 bits (83), Expect = 0.008 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 297 KVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTSPDKSLDTCLTQ 476 ++DG W I + D + CVLKD + D ++ E+V L+ P + CL Sbjct: 194 EIDGFWRVIDENYLDVILRMLLHNCVLKDWSFDDLDEDEVVNALVADEFPSQLASHCLRV 253 Query: 477 V-DKMSESDKLK 509 K++E+DK K Sbjct: 254 FGSKVNETDKWK 265 >At4g12960.1 68417.m02025 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 233 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +1 Query: 94 RLVCF--LMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVW 237 +LV F L+LL + + KVK+ +YYESLCP ++FI L ++ Sbjct: 8 KLVFFGCLLLLTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLGKIF 57 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 201 QEVYNDATGSRLE-GLQRTVKVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVL 377 QE D G + L +K+ P+G + ++ + C HG +EC N ++AC L Sbjct: 46 QEFIVDDLGKIFDYDLYTITDLKLFPFGNA---ELSDNLTVTCQHGEEECKLNALEACAL 102 Query: 378 K 380 + Sbjct: 103 R 103 >At1g07080.1 68414.m00754 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 265 Score = 35.1 bits (77), Expect = 0.044 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 157 KVKIAVYYESLCPDSKKFITTQLAPVWRD 243 KV + +YYESLCP FI LA ++ D Sbjct: 38 KVSVGLYYESLCPYCSSFIVNHLAKLFED 66 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +2 Query: 512 CASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKYDKDVETQAFENLKAVVCR 676 C SS G+ L Y +T+A+ P +VP V++ D + +EN + +C+ Sbjct: 155 CLSSGHGNELALHYAAETNALQPPHKYVPWVVV----DGQPLYEDYENFISYICK 205 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Frame = +3 Query: 321 ICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTSPDK--SLDTCLTQVDKMSE 494 +C HGA EC+ + V+AC + D + ++ + C+ + K +TC +++ S+ Sbjct: 92 VCQHGAFECFLDTVEACAI-DAWPKVSDHFPFIYCVEKLVTEHKYDKWETCYEKLNLNSK 150 Query: 495 --SDKLKDAH 518 +D L H Sbjct: 151 PVADCLSSGH 160 >At4g12890.1 68417.m02017 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 232 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +1 Query: 154 HKVKIAVYYESLCPDSKKFITTQLAPVW 237 +KVKI +YYESLCP + FI L ++ Sbjct: 37 NKVKINLYYESLCPYCQNFIVDDLGKIF 64 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +3 Query: 243 LQRTVKVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTE-KMEIV 419 L + +K+VP+G + + + C HG +EC N ++AC + R L D + + + + Sbjct: 68 LLKITDLKLVPFGNA---HISNNLTITCQHGEEECKLNALEACGI--RTLPDPKLQYKFI 122 Query: 420 ICLMNQTS 443 C+ T+ Sbjct: 123 RCVEKDTN 130 >At5g01580.1 68418.m00073 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 233 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +3 Query: 240 GLQRTVKVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVL 377 GL ++ +++VP+G + + DG + +C HG EC N + AC + Sbjct: 55 GLISSIDLQLVPWGNAAI-RPDG--TILCQHGEAECALNAIHACAI 97 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +1 Query: 82 MKTLRLVCFLMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVW 237 M + + +C + + KV +++YYE+LCP +FI +L ++ Sbjct: 1 MASYQRLCITSCTIFFCLLSLSSSQKVTLSLYYEALCPFCAEFIVNRLPKIF 52 >At4g21020.1 68417.m03041 late embryogenesis abundant domain-containing protein / LEA domain-containing protein low similarity to SP|P23283 Desiccation-related protein {Craterostigma plantagineum}; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 266 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 210 YNDATGSRLEGLQRTVKVKMVPYGKSTHDKVDGKW 314 Y + T + EG + TVK K G+ T + V G W Sbjct: 179 YGEDTKEKAEGFKETVKGKAEELGEKTKETVKGAW 213 >At1g56510.1 68414.m06498 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1007 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +3 Query: 375 LKDRNLQDTEKMEI---VICLMNQTSPDKSLDTCLTQVDKMSESDKLKDAH 518 L + N+QD+E ++ CL N D S +CLT++ +S + L+D + Sbjct: 603 LVEVNMQDSELQKLWEGTQCLANLKKIDLSRSSCLTELPDLSNATNLEDLY 653 >At4g38350.1 68417.m05422 patched family protein similar to SP|O15118 Niemann-Pick C1 protein precursor from Homo sapiens (PID:g2276463); contains Pfam profile PF02460 Patched family Length = 1064 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 100 VCFLMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWR 240 V ++ LC + K E K+ V ES + KKF T L+P +R Sbjct: 315 VAIVLALCSGLYNFKVETRPEKLWVGPESKAAEEKKFFDTHLSPFYR 361 >At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PGP1) identical to P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; homologous to mammalian mdr gene,contains ATP-binding cassette; related to multi drug resistance proteins Length = 1286 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = -3 Query: 252 SSEVPPDGSQLRRYKLLAVRTKGFVIDRYFDLMVFGFLLRHDIAEQHQKANQPESLHLVV 73 S V DG +R+Y L A+R ++ + + +FG + +IA H+ A + E + Sbjct: 1080 SGRVMIDGKDIRKYNLKAIRKHIAIVPQ--EPCLFGTTIYENIAYGHECATEAEIIQAAT 1137 Query: 72 LYQEKK 55 L K Sbjct: 1138 LASAHK 1143 >At1g42470.1 68414.m04897 patched family protein similar to SP|O15118 Niemann-Pick C1 protein precursor from Homo sapiens (GB:AAB63982) (GI:2276463); contains Pfam profile PF02460 Patched family Length = 1272 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 100 VCFLMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWR 240 V ++LLC + + K E K+ V S + K+F T LAP +R Sbjct: 356 VSVVLLLCVGLIRFKVETRPDKLWVGSGSRAAEEKQFFDTHLAPFYR 402 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 359 GASLRPEGPQPPGHGEDGDCNMPHEPDQPRQ 451 G S+ P GP PP H G P+ P +Q Sbjct: 776 GYSIPPYGPPPPYHTPHGQAPQPYPPQAQQQ 806 >At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DNA topoisomerase II / DNA gyrase (TOP2) identical to SP|P30182 DNA topoisomerase II (EC 5.99.1.3) {Arabidopsis thaliana} Length = 1473 Score = 28.3 bits (60), Expect = 5.0 Identities = 22/80 (27%), Positives = 32/80 (40%) Frame = +3 Query: 390 LQDTEKMEIVICLMNQTSPDKSLDTCLTQVDKMSESDKLKDAHPVNKETICSRRTVIKRM 569 L D +KM I + M +T+P + L +DK E LKDA ++ K Sbjct: 1137 LADRDKMIIAVADMKKTTPKSLWLSDLESLDKELEKLDLKDAQVQQAIEAAQKKIRAKSG 1196 Query: 570 L**DLSRSCPPLLLTRNTTK 629 + R P + TTK Sbjct: 1197 AAVKVKRQAPKKPAPKKTTK 1216 >At3g18290.1 68416.m02326 zinc finger protein-related weak alignment to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING finger) (2 copies) Length = 1254 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 205 SCCQDKGIRNRPLF*PYGLRFSSSPRHSRAASESKPAGESSSCC 74 SCCQ + R ++P + A+ KP+G SCC Sbjct: 563 SCCQHQDKRPAKRTAVLSCEKKTTPHSTEVANGCKPSGNGRSCC 606 >At5g39440.1 68418.m04777 Snf1-related protein kinase, putative similar to SNF1-related protein kinase KIN10 (EC 2.7.1.-) (AKIN10) [Arabidopsis thaliana] SWISS-PROT:Q38997 Length = 494 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = -3 Query: 198 VRTKGFVIDRYFDLMVFGFLLRHDIAEQHQKANQPESLHLVVLYQEKKRLYDF 40 ++ G I ++ + FL+ I Q++ P +++V+ Y + L+D+ Sbjct: 55 IKNMGIEIKVQREIKILRFLMHPHIIRQYEVIETPNDIYVVMEYVKSGELFDY 107 >At4g37060.1 68417.m05248 patatin, putative similar to patatin-like latex allergen [Hevea brasiliensis][PMID:10589016]; contains patatin domain PF01734 Length = 414 Score = 27.9 bits (59), Expect = 6.7 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -3 Query: 621 YFSLIITVGTNARGLITASVLSP-------YDASRLSPCSLDAHLSVYPTPTSCPLELST 463 YF +I GT+ GL+TA + +P + A + P L+ ++P PT L Sbjct: 58 YFDVI--AGTSTGGLVTAMLTAPDENGRPRFAAKEIVPFYLEHCPKIFPQPTGVLALLPK 115 Query: 462 CPKTCRG 442 PK G Sbjct: 116 LPKLLSG 122 >At1g06490.1 68414.m00688 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1933 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 7/69 (10%) Frame = +1 Query: 118 LCYVVAKKKTEDHKVKIA-VY------YESLCPDSKKFITTQLAPVWRDFRGLSKSKWSR 276 LCY+ E H + VY YE+ PD + F+ + P+++ R + + ++ Sbjct: 363 LCYIFHNMANEVHGILFGNVYPVTGDTYEAGAPDEEAFLRNVITPIYQVLR--KEVRRNK 420 Query: 277 MGRARTTRW 303 G+A ++W Sbjct: 421 NGKASHSKW 429 >At5g51750.1 68418.m06417 subtilase family protein similar to subtilisin-like protease GI:3687307 from [Lycopersicon esculentum] Length = 780 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 139 KKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWRDFRG 252 ++ DH V + V + P+S+ F T ++PV +RG Sbjct: 141 ERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPATWRG 178 >At4g00416.1 68417.m00056 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 163 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 160 VKIAVYYESLCPDSKKF 210 VK+ VYYESL P K+F Sbjct: 90 VKVDVYYESLAPRRKRF 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,256,310 Number of Sequences: 28952 Number of extensions: 354901 Number of successful extensions: 1139 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -