BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30313 (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.5 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 2.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -3 Query: 421 LRLLVSICFQTFFSNSFSFCILFLVTRTK*INVVVIVVFRC 299 + LL+ +C F+ FC F++ + ++ I F C Sbjct: 250 VHLLLLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYC 290 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.0 bits (47), Expect = 2.6 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 577 NKLQIMCVIEDDKVSVDLLTEKIQEFEDFV-QSVDIAAFNKI*TAITCNIFIS 732 N+L +C + D+K+S +LT + F + Q + +K T T FIS Sbjct: 272 NRLCHLCFLLDEKLSYIILTSFLNNFYFIIFQVFESFYLHKATTLETVYYFIS 324 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,308 Number of Sequences: 336 Number of extensions: 3409 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -