BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30313 (735 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1580 + 27888275-27888360,27888755-27888871,27888964-278890... 86 3e-17 03_04_0016 + 16461542-16461566,16462701-16462732,16463015-164631... 85 4e-17 07_03_1260 - 25260872-25261101,25261199-25261312,25261473-252615... 84 1e-16 01_06_1167 - 35062766-35062870,35063165-35063228,35063647-350637... 36 0.025 02_04_0193 - 20801959-20802583,20803372-20803448,20803530-208036... 28 6.7 >07_03_1580 + 27888275-27888360,27888755-27888871,27888964-27889045, 27889710-27889821,27889958-27890071,27890163-27890326 Length = 224 Score = 85.8 bits (203), Expect = 3e-17 Identities = 44/67 (65%), Positives = 51/67 (76%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVD-LLTEKIQE--FEDFVQSVD 678 +R+++MEGL WGASKLVPVGYGI KLQIM I DD VSVD L+ E + E +FVQS D Sbjct: 158 VRSVQMEGLTWGASKLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTEEPINEFVQSCD 217 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 218 IVAFNKI 224 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/57 (43%), Positives = 36/57 (63%) Frame = +3 Query: 48 DVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQIAS 218 D+ TA GL L Q+L+ K+YVSG S+ D++VF V P A P+ RWY+ +A+ Sbjct: 7 DLHTADGLKALEQHLSGKTYVSGNAISKDDIKVFAAVPSKPGAEFPNAARWYDTVAA 63 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +2 Query: 404 ADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 A K S K KSS+LLDVKPWDDETDMK++E Sbjct: 123 ASKASSKKKESGKSSVLLDVKPWDDETDMKKLE 155 >03_04_0016 + 16461542-16461566,16462701-16462732,16463015-16463100, 16463189-16463305,16463399-16463474,16463695-16463818, 16464482-16464595,16464700-16464947 Length = 273 Score = 85.4 bits (202), Expect = 4e-17 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEK---IQEFEDFVQSVD 678 +R ++MEGLLWGASKLVPVGYGI KLQIM I DD VSVD L E + +F+QS D Sbjct: 179 VRNVKMEGLLWGASKLVPVGYGIKKLQIMMTIVDDLVSVDSLIEDYFYTEPANEFIQSCD 238 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 239 IVAFNKI 245 Score = 56.4 bits (130), Expect = 2e-08 Identities = 24/61 (39%), Positives = 40/61 (65%) Frame = +3 Query: 36 MAVGDVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQIA 215 + + +V + GL L++YL +SY+SGY S+ D+ VF + APAA+ +V RWY+ I+ Sbjct: 22 ITLSNVNSEAGLQKLDEYLLTRSYISGYQASKDDMTVFTSLPSAPAASYVNVTRWYDHIS 81 Query: 216 S 218 + Sbjct: 82 A 82 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +2 Query: 395 KAYADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 +A A K S K KSS+LLDVKPWDDETDM ++E Sbjct: 141 RAAAVKASGKKKESGKSSVLLDVKPWDDETDMAKLE 176 >07_03_1260 - 25260872-25261101,25261199-25261312,25261473-25261596, 25261755-25261839,25261917-25262033,25262122-25262207 Length = 251 Score = 84.2 bits (199), Expect = 1e-16 Identities = 42/67 (62%), Positives = 49/67 (73%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEK---IQEFEDFVQSVD 678 +R ++MEGLLWGASKLVPVGYGI KLQIM I DD VSVD L E + +++QS D Sbjct: 163 VRNVKMEGLLWGASKLVPVGYGIKKLQIMMTIVDDLVSVDSLIEDYFYTEPANEYIQSCD 222 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 223 IVAFNKI 229 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +3 Query: 48 DVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQI 212 +V + GL L++YL +SY+SGY S D+ V+ AP+++ +V RW+ I Sbjct: 7 NVSSEAGLKKLDEYLLTRSYISGYQASNDDLAVYSAFSTAPSSSYTNVARWFTHI 61 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +2 Query: 395 KAYADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 +A A K S K KSS+LLDVKPWDDETDM ++E Sbjct: 125 RAAAVKASGKKKESGKSSVLLDVKPWDDETDMTKLE 160 >01_06_1167 - 35062766-35062870,35063165-35063228,35063647-35063738, 35064137-35064205,35064322-35064412,35064509-35064732, 35065064-35065180,35065583-35065651,35066172-35066237, 35066335-35066505,35066581-35066661,35067620-35067700 Length = 409 Score = 36.3 bits (80), Expect = 0.025 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 9/57 (15%) Frame = +3 Query: 69 LNDLNQYLAEKSYV--SGYTPSQADVQVFEQV-------GKAPAANLPHVLRWYNQI 212 L +LNQ L++KS + +G+ PS AD+ VF + G+ PHVLRW + I Sbjct: 76 LGNLNQDLSQKSVLLGNGFKPSVADIVVFATIQVFVSHLGENELQKYPHVLRWMDYI 132 >02_04_0193 - 20801959-20802583,20803372-20803448,20803530-20803646, 20804147-20804250,20804359-20804428,20804547-20804644, 20804747-20804840,20805269-20805359,20805453-20805545, 20805635-20805960,20806162-20806641 Length = 724 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +3 Query: 123 PSQADVQVFEQVGKAPA-ANLPHVLRWYNQIASYTSAERKTWSQGPAH*PPVLNPRLPPQ 299 P ++ F KA A + ++ W + + SY+ S+ P+ P P PP Sbjct: 528 PDVIKIETFYHADKAKTEACILDLVLWLHHLISYSRPSNGGRSRSPSRSPVRSPPLTPPH 587 Query: 300 QRKTTMTTT 326 Q TT +++ Sbjct: 588 QVPTTTSSS 596 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,071,674 Number of Sequences: 37544 Number of extensions: 370127 Number of successful extensions: 929 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -