BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30313 (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59042| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_52162| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_42516| Best HMM Match : EF1_GNE (HMM E-Value=3.3e-05) 55 7e-08 SB_15649| Best HMM Match : EF1_GNE (HMM E-Value=0.025) 54 9e-08 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 29 5.2 >SB_59042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 101 bits (243), Expect = 5e-22 Identities = 47/66 (71%), Positives = 56/66 (84%) Frame = +1 Query: 502 KPIRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEKIQEFEDFVQSVDI 681 K +R+I+ +GLLWGASKLVP+ YGI KLQI V+EDDK+S D L E+I +FEDFVQSVDI Sbjct: 160 KLVRSIQADGLLWGASKLVPLAYGIKKLQITVVVEDDKISTDFLEEEICKFEDFVQSVDI 219 Query: 682 AAFNKI 699 AAFNKI Sbjct: 220 AAFNKI 225 Score = 84.2 bits (199), Expect = 1e-16 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = +3 Query: 36 MAVGDVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQIA 215 M GD+K+ GL+ LN +L E+SY+ GY PSQAD VFE + AP A+LPH LRWYN I Sbjct: 1 MGFGDLKSQAGLSALNTFLTERSYIEGYVPSQADAVVFEALKSAPPASLPHALRWYNHIV 60 Query: 216 SY 221 SY Sbjct: 61 SY 62 Score = 69.3 bits (162), Expect = 3e-12 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = +2 Query: 326 VDLFGSGXXXXXXXXXXXXXXXLKAYADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 +DLFGS LKAY +KK+KK +IAKS+I+LDVKPWDDETDM EME Sbjct: 101 IDLFGSDDEEEEKEAARIRQERLKAYEEKKAKKKPVIAKSNIMLDVKPWDDETDMAEME 159 >SB_52162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 54.8 bits (126), Expect = 7e-08 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 117 YTPSQADVQVFEQVGKAPAANLPHVLRWYNQIASY 221 Y PSQAD VFE + AP A+LPH LRWYN I SY Sbjct: 2 YVPSQADAVVFEALKSAPPASLPHALRWYNHIVSY 36 >SB_42516| Best HMM Match : EF1_GNE (HMM E-Value=3.3e-05) Length = 416 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +1 Query: 547 SKLVPVGYGINKLQIMCVIEDDKVSVDLLTEKIQEFEDF 663 +KLV + YG+ KLQI CVIED KVS D L +K+ EFEDF Sbjct: 116 TKLVEIAYGLKKLQITCVIEDAKVSTDDLIDKLCEFEDF 154 >SB_15649| Best HMM Match : EF1_GNE (HMM E-Value=0.025) Length = 301 Score = 54.4 bits (125), Expect = 9e-08 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 550 KLVPVGYGINKLQIMCVIEDDKVSVDLLTEKIQEFEDF 663 KLV + YG+ KLQI CVIED KVS D L +K+ EFEDF Sbjct: 2 KLVEIAYGLKKLQITCVIEDAKVSTDDLIDKLCEFEDF 39 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 69 LNDLNQYLAEKSYVSGYTPSQADVQ-VFEQVGK 164 +N L + L EKS+ GY+P+ +DVQ V + V K Sbjct: 62 VNKLPKGLIEKSWNFGYSPNTSDVQTVMQNVAK 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,480,612 Number of Sequences: 59808 Number of extensions: 408236 Number of successful extensions: 914 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -