BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30313 (735 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18110.1 68415.m02105 elongation factor 1-beta, putative / EF... 89 4e-18 At1g30230.1 68414.m03698 elongation factor 1-beta / EF-1-beta id... 88 5e-18 At5g12110.1 68418.m01422 elongation factor 1B alpha-subunit 1 (e... 79 2e-15 At5g19510.1 68418.m02324 elongation factor 1B alpha-subunit 2 (e... 76 2e-14 At2g40660.1 68415.m05017 tRNA-binding region domain-containing p... 35 0.064 At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS... 29 3.2 At2g05170.1 68415.m00544 vacuolar protein sorting 11 family prot... 28 5.6 At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 28 7.4 At5g18830.1 68418.m02237 squamosa promoter-binding protein-like ... 28 7.4 At1g68210.1 68414.m07792 two-component responsive regulator fami... 28 7.4 At2g36190.1 68415.m04442 beta-fructosidase, putative / beta-fruc... 27 9.8 >At2g18110.1 68415.m02105 elongation factor 1-beta, putative / EF-1-beta, putative nearly identical to eEF-1beta [Arabidopsis thaliana] GI:398606 Length = 231 Score = 88.6 bits (210), Expect = 4e-18 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEK---IQEFEDFVQSVD 678 +R+I+MEGL WGASKLVPVGYGI KL IMC I DD VS+D + E+ ++ ++VQS D Sbjct: 165 VRSIQMEGLFWGASKLVPVGYGIKKLHIMCTIVDDLVSIDTMIEEQLTVEPINEYVQSCD 224 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 225 IVAFNKI 231 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/58 (34%), Positives = 35/58 (60%) Frame = +3 Query: 39 AVGDVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQI 212 A ++ + GL L+++L +SY++GY S+ D+ VF + K P + +V RW+N I Sbjct: 3 AFPNLNSGSGLKKLDEHLLTRSYITGYQASKDDITVFTALSKPPTSEFVNVSRWFNHI 60 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +2 Query: 395 KAYADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 +A + K S K KSS+L+D+KPWDDETDMK++E Sbjct: 127 RAASVKASTKKKESGKSSVLMDIKPWDDETDMKKLE 162 >At1g30230.1 68414.m03698 elongation factor 1-beta / EF-1-beta identical to SP|P48006 Elongation factor 1-beta (EF-1-beta) {Arabidopsis thaliana} Length = 231 Score = 88.2 bits (209), Expect = 5e-18 Identities = 40/67 (59%), Positives = 52/67 (77%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEK---IQEFEDFVQSVD 678 +++I+MEGL WGASKLVPVGYGI KLQI+C I DD VS+D + E+ ++ ++VQS D Sbjct: 165 VKSIQMEGLFWGASKLVPVGYGIKKLQILCTIVDDLVSIDTMIEEQLTVEPINEYVQSCD 224 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 225 IVAFNKI 231 Score = 48.4 bits (110), Expect = 5e-06 Identities = 20/58 (34%), Positives = 34/58 (58%) Frame = +3 Query: 39 AVGDVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQI 212 A ++ + GL L+++L +SY++GY S+ D+ VF + K P + + RWYN I Sbjct: 3 AFPNLNSDAGLKKLDEHLLTRSYITGYQASKDDITVFAALAKPPTSQYVNASRWYNHI 60 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +2 Query: 395 KAYADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 +A + K S K KSS+L+D+KPWDDETDMK++E Sbjct: 127 RAASVKASTKKKESGKSSVLIDIKPWDDETDMKKLE 162 >At5g12110.1 68418.m01422 elongation factor 1B alpha-subunit 1 (eEF1Balpha1) identical to elongation factor 1B alpha-subunit [Arabidopsis thaliana] GI:6686819 Length = 228 Score = 79.4 bits (187), Expect = 2e-15 Identities = 41/67 (61%), Positives = 48/67 (71%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEKIQEFE---DFVQSVD 678 +R+++M GL WGASKLVPVGYGI KL IM I DD VSVD L E E +++QSVD Sbjct: 162 VRSVQMPGLTWGASKLVPVGYGIKKLTIMMTIVDDLVSVDNLIEDHLTSEPNNEYIQSVD 221 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 222 IVAFNKI 228 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/58 (37%), Positives = 36/58 (62%) Frame = +3 Query: 48 DVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQIASY 221 D+ T +GL L ++LA K+Y+SG S DV+V+ V + P P+ +WY+ +AS+ Sbjct: 7 DLHTERGLKTLEEHLAGKTYISGDQLSVDDVKVYAAVLENPGDGFPNASKWYDSVASH 64 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 404 ADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 A K +KK KSS+LL+VKPWDDETDMK++E Sbjct: 127 AKKDTKKTKESGKSSVLLEVKPWDDETDMKKLE 159 >At5g19510.1 68418.m02324 elongation factor 1B alpha-subunit 2 (eEF1Balpha2) identical to elongation factor 1B alpha-subunit [Arabidopsis thaliana] GI:6686821 Length = 224 Score = 76.2 bits (179), Expect = 2e-14 Identities = 40/67 (59%), Positives = 45/67 (67%), Gaps = 3/67 (4%) Frame = +1 Query: 508 IRTIEMEGLLWGASKLVPVGYGINKLQIMCVIEDDKVSVDLLTEKIQEFE---DFVQSVD 678 +R +EM GL WGASKLVPVGYGI KL IM I DD VS D L E E +++QS D Sbjct: 158 VRGVEMPGLFWGASKLVPVGYGIKKLTIMFTIVDDLVSPDNLIEDFLTSEPNNEYIQSCD 217 Query: 679 IAAFNKI 699 I AFNKI Sbjct: 218 IVAFNKI 224 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 404 ADKKSKKPALIAKSSILLDVKPWDDETDMKEME 502 A K +KKP KSS+L+DVKPWDDETDMK++E Sbjct: 123 AKKDTKKPKESGKSSVLMDVKPWDDETDMKKLE 155 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +3 Query: 48 DVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANLPHVLRWYNQIAS 218 D+ T +G+ + ++LA K+Y+SG S DV+V+ V P+ P+ +WY +AS Sbjct: 7 DLHTEEGVKSVEEHLAGKTYISGDQLSVDDVKVYAAVPVKPSDAFPNASKWYESVAS 63 >At2g40660.1 68415.m05017 tRNA-binding region domain-containing protein similar to SP|Q12904 Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] {Homo sapiens}; contains Pfam profile PF01588: Putative tRNA binding domain Length = 389 Score = 34.7 bits (76), Expect = 0.064 Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 9/57 (15%) Frame = +3 Query: 69 LNDLNQYLAEKSYV--SGYTPSQADVQVFEQV-------GKAPAANLPHVLRWYNQI 212 L LN LA KS + +G TPS ADV VF + + +PHV+RW N I Sbjct: 76 LEKLNLELATKSVLLGNGLTPSAADVAVFSALHSSVLGLSDSDKEKVPHVIRWVNYI 132 >At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. identical to RPS2 (gi:13661831) Length = 909 Score = 29.1 bits (62), Expect = 3.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 726 KYITCYGCLDFVKCSNVNRLYK 661 +Y++C+GC D+ C V+ + K Sbjct: 103 RYLSCFGCADYKLCKKVSAILK 124 >At2g05170.1 68415.m00544 vacuolar protein sorting 11 family protein / VPS11 family protein similar to Vacuolar protein sorting 11 (hVPS11) (PP3476) (Swiss-Prot:Q9H270) [Homo sapiens]; similar to Vacuolar biogenesis protein END1 (PEP5 protein) (Vacuolar protein sorting 11) (Swiss-Prot:P12868) [Saccharomyces cerevisiae] Length = 932 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 69 LNDLNQYLAEKSYVSGYTPSQADVQVFEQVGK 164 L DL Y YVS PSQA V + EQ GK Sbjct: 495 LEDLGNYDEALQYVSSLEPSQAGVTI-EQYGK 525 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 123 PSQADVQVFEQVGKAPAANLPHVLRWYNQIASYTSAERKTWSQGPAH*PPVLNPRLPP 296 P + D+Q V P+ + W + + + ER Q H PPVL+P LPP Sbjct: 10 PPEMDIQPPALVNDDPSTYSSALWDW-GDLLDFAADERLLVDQ--IHFPPVLSPPLPP 64 >At5g18830.1 68418.m02237 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 801 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 123 PSQADVQVFEQVGKAPAANLPHVLRWYNQIASYTSAERKTWSQGPAH*PPVLNPRLPP 296 P + D+Q V P+ + W + + + ER Q H PPVL+P LPP Sbjct: 10 PPEMDIQPPALVNDDPSTYSSALWDW-GDLLDFAADERLLVDQ--IHFPPVLSPPLPP 64 >At1g68210.1 68414.m07792 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 663 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 598 VIEDDKVSVDLLTEKIQEFEDFVQSVDIAA 687 +I+ D S+ LT +Q+F V SVD+A+ Sbjct: 17 LIDHDTASIASLTSMLQQFSKRVMSVDVAS 46 >At2g36190.1 68415.m04442 beta-fructosidase, putative / beta-fructofuranosidase, putative similar to beta-fructofuranosidase GI:18324 from [Daucus carota] Length = 591 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 69 LNDLNQYLAEKSYVSGYTPSQADVQVFEQVGKAPAANL 182 +N+ + + ++ V G TP+QADV+V VG A + Sbjct: 386 MNNHDIKMGQRIEVKGITPAQADVEVTFYVGSLEKAEI 423 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,375,168 Number of Sequences: 28952 Number of extensions: 291955 Number of successful extensions: 803 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -