BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30312 (697 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Sc... 28 1.1 SPAC20G8.08c |fft1||fun thirty related protein Fft1|Schizosaccha... 27 1.9 SPBP35G2.09 |usp103|yhc1|U1 snRNP-associated protein Usp103 |Sch... 27 2.6 SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosac... 26 5.9 >SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 28.3 bits (60), Expect = 1.1 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = -1 Query: 277 LFELFAGLNFISVVLKVE-EVTKLYSSPSLRSSTVGVTALAALRVIRPTPMVFMNSSKFS 101 + +LFA + SV L + + + + P + +T LAA R V N +KFS Sbjct: 216 ILKLFANIVANSVALTHDYSLQQSHEDPIIEPDNKFLTELAAYFYFRQQGWVVKNGTKFS 275 Query: 100 EEVILY 83 + +LY Sbjct: 276 VDFLLY 281 >SPAC20G8.08c |fft1||fun thirty related protein Fft1|Schizosaccharomyces pombe|chr 1|||Manual Length = 944 Score = 27.5 bits (58), Expect = 1.9 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 263 EEFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLEVTYVREFGPEEMKAVMTAKDV 430 EE ED G + CT + N + + D +E + GP E++ M+ DV Sbjct: 220 EETNEDDLLGQS-PTACTTDANIDNSIPENSDKIEEVSIESSGPSEVEDEMSEYDV 274 >SPBP35G2.09 |usp103|yhc1|U1 snRNP-associated protein Usp103 |Schizosaccharomyces pombe|chr 2|||Manual Length = 182 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 435 APESTRSSKRTLLRGRESVPPIHEHPR 515 AP++T SS L + ++S+P +EH R Sbjct: 128 APQTTASSNTQLTQQQQSLPQTNEHQR 154 >SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 853 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 513 RHNYVYLASILYISPF*LYCKTNFSFHI-SHRLPFELQK 626 +H Y+YLA L+ L C F F++ ++R F L K Sbjct: 63 KHRYIYLAVCLFFLASVLSCAIIFRFYLHTNRENFSLFK 101 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,703,138 Number of Sequences: 5004 Number of extensions: 52504 Number of successful extensions: 150 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -