BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30312 (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24880.1 68418.m02946 expressed protein ; expression supporte... 28 6.8 At4g03480.1 68417.m00475 ankyrin repeat family protein contains ... 28 6.8 At3g19970.1 68416.m02527 expressed protein 28 6.8 At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-r... 27 9.0 At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to... 27 9.0 At1g27040.2 68414.m03296 nitrate transporter, putative contains ... 27 9.0 At1g27040.1 68414.m03297 nitrate transporter, putative contains ... 27 9.0 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 2 GAKNRRIKNLSLKSIKLIYKNGIRRQEIQDDFLREL**VHEDHRRGSDH 148 G++N RIK S K I L + Q+D E+ V DH + SDH Sbjct: 173 GSENVRIKKASDKEIAL---DSASMSSAQEDHQEEILKVESDHLQVSDH 218 >At4g03480.1 68417.m00475 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 617 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 304 IRMHIRRQHPEASPEGPRRS*SHLRQGIRP 393 +R H+ R PEASP P S S+ R + P Sbjct: 2 VRSHLLRATPEASPLKPASSPSNCRLSLSP 31 >At3g19970.1 68416.m02527 expressed protein Length = 434 Score = 27.9 bits (59), Expect = 6.8 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -1 Query: 289 VSAVLFELFAGLNFIS-VVLKVEEVTKLYSSPSLRSSTVGVTALAALRVI 143 VS V A L+F+S + + V V L S+PS +T VT+L+ALR + Sbjct: 62 VSQVSASKLADLSFVSRICVPVPNVDLLASNPSCSLAT-SVTSLSALRSV 110 >At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1094 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/54 (40%), Positives = 29/54 (53%) Frame = +3 Query: 318 SKATP*SKSRRPPTVLKSLTSGNSALRR*KL**QLRT*LAPESTRSSKRTLLRG 479 SK P SK RR + K TS +S+L + + + L PEST SS RT+ G Sbjct: 736 SKEKPQSKKRRDRSKKKPSTSISSSLDK-TVEHKPSVNLKPESTSSSLRTIEEG 788 >At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 585 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 87 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDG 200 K T +E ++ IGVGL+ A AV VE+++ G Sbjct: 414 KATKTETGVTHLQRIGVGLVLSILAMAVAALVEIKRKG 451 >At1g27040.2 68414.m03296 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 563 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 87 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 194 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 393 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 428 >At1g27040.1 68414.m03297 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 567 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 87 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 194 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 397 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 432 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,419,908 Number of Sequences: 28952 Number of extensions: 290642 Number of successful extensions: 784 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -