BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30308X (436 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A10.10c |sla1||La protein homolog|Schizosaccharomyces pomb... 58 6e-10 SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 46 3e-06 SPAC3G9.07c |hos2|hda1, phd1|histone deacetylase |Schizosaccharo... 27 0.94 SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |... 26 2.9 SPBC106.19 ||SPBC582.01|sequence orphan|Schizosaccharomyces pomb... 26 2.9 SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 25 3.8 SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces pom... 25 3.8 SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha... 25 3.8 SPBC29A10.08 |||1,3-beta-glucanosyltransferase |Schizosaccharomy... 25 5.0 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 25 5.0 SPAC6B12.12 |tom70||mitochondrial TOM complex subunit Tom70|Schi... 25 5.0 SPBC365.13c |hba1|caf1|Ran GTPase binding protein Hba1|Schizosac... 25 6.7 SPAC16A10.02 |||transcription coactivator Sub1 |Schizosaccharomy... 25 6.7 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 24 8.8 SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyce... 24 8.8 SPBC337.06c |cwf15||complexed with Cdc5 protein Cwf15 |Schizosac... 24 8.8 SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces... 24 8.8 SPCC24B10.19c |||sequence orphan|Schizosaccharomyces pombe|chr 3... 24 8.8 >SPAC57A10.10c |sla1||La protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 298 Score = 58.0 bits (134), Expect = 6e-10 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 ++QVE+YF D NL DKFL + +DGWVP++ + F R+ + + + I NAL KS Sbjct: 68 LKQVEFYFSDTNLPHDKFLWTTSQKNDGWVPIQTIANFKRMRRF-QPLEAIVNALRKS 124 >SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 46.0 bits (104), Expect = 3e-06 Identities = 22/56 (39%), Positives = 34/56 (60%) Frame = +3 Query: 261 QVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 Q+EYYF NL +D FL++ + D+G+VPL L FNR+ + D +++ A S Sbjct: 332 QLEYYFSIENLCKDMFLRKHMD-DEGYVPLAFLASFNRIKSFSTDLNLLHAACKAS 386 >SPAC3G9.07c |hos2|hda1, phd1|histone deacetylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 434 Score = 27.5 bits (58), Expect = 0.94 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = -2 Query: 339 IRHLILFVLAEIYLDVDLHHQNNIRLAEYRN 247 I +++ F +Y+D+D+HH + ++ A Y + Sbjct: 177 ILNMLRFFPRVLYIDIDIHHGDGVQQAFYES 207 >SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 25.8 bits (54), Expect = 2.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 157 MTEDKEVTVETNGQEENAKTENSEDE 234 + ED V + +E N + EN+EDE Sbjct: 464 LVEDTSVDISATLEEANTQQENAEDE 489 >SPBC106.19 ||SPBC582.01|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 25.8 bits (54), Expect = 2.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 334 SSNFICSCRNLSRC 293 S NF+CSCR S C Sbjct: 7 SRNFLCSCRGFSVC 20 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 25.4 bits (53), Expect = 3.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 124 KESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETEL 243 +E+ + E ++ ED++V +ET+ +E K +TE+ Sbjct: 241 EEAVEAMEEDEVAEDEDVVLETSISQEEEKKNIENPDTEV 280 >SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 25.4 bits (53), Expect = 3.8 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 118 SIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETEL 243 S +E+ + +PE + T + T E +EE + E E+E E+ Sbjct: 331 SEEEAVKSLPETQRTTSRIETQEEEIKEEEMEGEEEEEEEEV 372 >SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 578 Score = 25.4 bits (53), Expect = 3.8 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +1 Query: 109 KVFSIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 K F +K + R + E+K + D+E +V+ +E+ +K E+ + + + Sbjct: 44 KAFLLKMAKRSVEELKRSADEEASVKR--KEKKSKHEHKKHKKD 85 >SPBC29A10.08 |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 25.0 bits (52), Expect = 5.0 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 186 FNSYLFVLGHFDFWNNTMRFFNGKYLLISENKFIEASKLRYTR 58 F+SY V+ F +NNT FF G ++ N A + Y R Sbjct: 132 FSSYQSVIDTFQKYNNTGAFFAGNEVV---NNASNAPAVAYVR 171 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 25.0 bits (52), Expect = 5.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 376 RRLNFVRISNGTHPSSNFICSCRNLSRCRF 287 R N R+ + P+SN +C RN S+CRF Sbjct: 352 RSSNRFRLFPASTPNSNGLC--RNDSKCRF 379 >SPAC6B12.12 |tom70||mitochondrial TOM complex subunit Tom70|Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.0 bits (52), Expect = 5.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 124 KESHRVIPEIKMTEDKEVTVETNGQEENAKTENSED 231 K SH+ ++K +DK + G+ E AK ED Sbjct: 55 KASHKRSKKLKAHQDKAESKVNEGKNEAAKVVKEED 90 >SPBC365.13c |hba1|caf1|Ran GTPase binding protein Hba1|Schizosaccharomyces pombe|chr 2|||Manual Length = 399 Score = 24.6 bits (51), Expect = 6.7 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +1 Query: 103 NQKVFSIKE---SHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELDI 249 N +V KE S+ V PE+++TE ++ E+N E T +E EL + Sbjct: 59 NAEVKEFKETTKSNGVKPEVEITESTKIQKESN-TEPCISTGGKVEEKELKV 109 >SPAC16A10.02 |||transcription coactivator Sub1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 136 Score = 24.6 bits (51), Expect = 6.7 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +1 Query: 148 EIKMTEDKEVTVETNGQEENAKTENSEDETELD 246 EIK + +++ + + N KTEN D++ ++ Sbjct: 103 EIKEKAENNASLKNDEDDLNTKTENKTDDSSVE 135 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 24.2 bits (50), Expect = 8.8 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 Query: 359 HKIQSPCQTDRGHRCHRKCP 418 H PC RG C CP Sbjct: 276 HSCGDPCGKTRGQDCEHPCP 295 >SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyces pombe|chr 3|||Manual Length = 563 Score = 24.2 bits (50), Expect = 8.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 166 DKEVTVETNGQEENAKTENSEDETELDIAIFGKSNI 273 + EV EEN + ENS T ++I + + N+ Sbjct: 48 ESEVIQTPTSVEENNEDENSMSTTTIEIPVVKRRNL 83 >SPBC337.06c |cwf15||complexed with Cdc5 protein Cwf15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 265 Score = 24.2 bits (50), Expect = 8.8 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 118 SIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 S K S I K + + +V+++ E + + +SEDET+ Sbjct: 128 SNKNSEVSIKRRKTESNSQESVDSSNSESSDEESDSEDETQ 168 >SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 491 Score = 24.2 bits (50), Expect = 8.8 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 118 SIKESHRVIPEIKMTEDKEVTVETNGQ---EENAKTENSEDE 234 S+KES E K T D +ETN EE+++ E EDE Sbjct: 173 SLKESDFESEE-KATNDNNGLIETNHNSKLEESSEHEEEEDE 213 >SPCC24B10.19c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 455 Score = 24.2 bits (50), Expect = 8.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 142 IPEIKMTEDKEVTVETNGQEENAKTENSEDET 237 +PE T EV E N +EN +N E T Sbjct: 293 VPESTTTNTTEVLKELNDIQENKSRKNVEKAT 324 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,657,708 Number of Sequences: 5004 Number of extensions: 31842 Number of successful extensions: 114 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -