BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30308X (436 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10576| Best HMM Match : La (HMM E-Value=6.9e-28) 56 2e-08 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 47 6e-06 SB_7622| Best HMM Match : Arfaptin (HMM E-Value=0) 30 0.72 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 29 2.2 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 28 2.9 SB_15630| Best HMM Match : p450 (HMM E-Value=0) 28 2.9 SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) 28 3.8 SB_1572| Best HMM Match : Drf_FH1 (HMM E-Value=0.27) 28 3.8 SB_41386| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_32578| Best HMM Match : Methyltransf_2 (HMM E-Value=2.2e-17) 27 6.7 SB_31931| Best HMM Match : Nucleoplasmin (HMM E-Value=1.9) 27 6.7 SB_14414| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_1006| Best HMM Match : GPP34 (HMM E-Value=3.6) 27 8.8 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_29514| Best HMM Match : MotA_ExbB (HMM E-Value=0.21) 27 8.8 SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_10576| Best HMM Match : La (HMM E-Value=6.9e-28) Length = 711 Score = 55.6 bits (128), Expect = 2e-08 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = +3 Query: 258 RQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVI 407 RQ+EYYF + NLH+D FL++Q+ D+G++P+ ++ F R+ LT D ++I Sbjct: 127 RQIEYYFSEANLHKDFFLRKQMD-DEGYIPIALIASFYRVQALTHDMNLI 175 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 47.2 bits (107), Expect = 6e-06 Identities = 19/57 (33%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +3 Query: 261 QVEYYFGDVNLHRDKFLQEQIK-LDDGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 Q+++YF D L +D+FL++QI+ DG+V + + FN++ ++T+D ++ A+ S Sbjct: 32 QIDFYFSDSALLKDRFLKQQIENHPDGYVAISTIASFNKIKQMTDDIKLVKKAMKLS 88 >SB_7622| Best HMM Match : Arfaptin (HMM E-Value=0) Length = 641 Score = 30.3 bits (65), Expect = 0.72 Identities = 22/58 (37%), Positives = 31/58 (53%) Frame = +1 Query: 73 LRSLNKLVF*NQKVFSIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELD 246 L+SLN LV N+K IKE H + + DK+ T E G+ AK N +D+ + D Sbjct: 294 LKSLNPLVTDNEKNDEIKEVHL---DQETHVDKKDT-ENAGEATEAKRSNDDDDDDDD 347 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 106 QKVFSIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELD 246 ++V +E V E + E+KE +E +EE + E E+E E D Sbjct: 39 EEVEKEEEEEEVEEEEEEEEEKEDEIEVEEEEEEKENEEEENEDEED 85 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 154 KMTEDKEVTVETNGQEENAKTENSEDE 234 K+T+DK+V E EE K E+ D+ Sbjct: 742 KLTQDKDVETENKNNEEKEKLEDDADQ 768 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 124 KESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELD 246 ++++ V P+ + D E GQE +T + ED+T +D Sbjct: 1148 EDTNGVRPDDEPLHDDEQDPNVAGQERGGRTNDEEDDTSVD 1188 >SB_15630| Best HMM Match : p450 (HMM E-Value=0) Length = 965 Score = 28.3 bits (60), Expect = 2.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 3 IKHVFFNLKAISLKLSGLTLYILTSKPQ*TCFLKSEGIFH*RISSCYSR 149 ++ VF +A S+ S T+Y+L + + L + ++H R S YSR Sbjct: 716 VRKVFITHRAQSIYYSRCTMYLLLTVHKVFITLGEQSLYHSRCSKDYSR 764 >SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) Length = 824 Score = 27.9 bits (59), Expect = 3.8 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 151 IKMTEDKEVTVETNGQEENAKTENSEDE 234 IK T + E+NG E NA E+SEDE Sbjct: 576 IKDTGMCNLAEESNGSESNATQEDSEDE 603 >SB_1572| Best HMM Match : Drf_FH1 (HMM E-Value=0.27) Length = 335 Score = 27.9 bits (59), Expect = 3.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 344 PIRNSHKIQSPCQTDRGHRCHRKCP 418 P+ H+I C+ + HR ++CP Sbjct: 84 PVTQDHRIPKRCRVTQDHRIPKRCP 108 >SB_41386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 27.5 bits (58), Expect = 5.0 Identities = 9/41 (21%), Positives = 24/41 (58%) Frame = +1 Query: 106 QKVFSIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSE 228 Q+ + +HR +P I+ +E+ + E + +++ + EN++ Sbjct: 71 QRTYPSWHAHREVPAIRKSEESSLEDEEDDEDDEEEKENTD 111 >SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 27.1 bits (57), Expect = 6.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 115 FSIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDE 234 +S + R++ E + +D++ E +EEN EN EDE Sbjct: 371 YSTRRRARLVSE-ETNDDEDEDEEEEEEEENEDEENGEDE 409 >SB_32578| Best HMM Match : Methyltransf_2 (HMM E-Value=2.2e-17) Length = 298 Score = 27.1 bits (57), Expect = 6.7 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 309 LQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNK 425 L+ KLD +G+V LTK+ R+ L T IA A+NK Sbjct: 106 LRGSSKLDAEGFVTAFDLTKYKRICDLGGATGEIAQAVNK 145 >SB_31931| Best HMM Match : Nucleoplasmin (HMM E-Value=1.9) Length = 165 Score = 27.1 bits (57), Expect = 6.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 127 ESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 ES+ ++ +K E++E E +EE + E E+E E Sbjct: 121 ESNMIMTTLKEEEEEEEEEEEEEEEEEEEEEEEEEEEE 158 >SB_14414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 2 Y*TRVFQFKSYFFKIVWPYLVYLNFEASINLFSEIRRYFPLKNLIVL 142 Y T + F++YF + +++ + + LF RY+P+KN I++ Sbjct: 290 YATPLQAFENYFVRHCCHVMLHTSIPEDVKLF----RYYPIKNTILM 332 >SB_1006| Best HMM Match : GPP34 (HMM E-Value=3.6) Length = 426 Score = 26.6 bits (56), Expect = 8.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 163 EDKEVTVETNGQEENAKTENSED 231 E +EV +ET +E A TEN E+ Sbjct: 294 EKREVQIETEQTKEGASTENKEN 316 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 26.6 bits (56), Expect = 8.8 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 136 RVIPE-IKMTEDKEVTVETNGQEENAKTENSE 228 RV+ E I+ T+DK V NGQE +A+ E Sbjct: 2700 RVLHEPIETTQDKGERVPVNGQESSARINEQE 2731 >SB_29514| Best HMM Match : MotA_ExbB (HMM E-Value=0.21) Length = 368 Score = 26.6 bits (56), Expect = 8.8 Identities = 19/58 (32%), Positives = 27/58 (46%) Frame = +2 Query: 68 LNFEASINLFSEIRRYFPLKNLIVLFQKSK*PRTKR*LLKPMDKRRTRKPKIQKTKPN 241 L+ EA I++F EIR FP LI F + + + L D + KP + PN Sbjct: 11 LSDEAKISIFQEIRDIFPNSKLI-SFNAFRRDKGRIWLFPDGDGAQVAKPMLVDGLPN 67 >SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1358 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +1 Query: 103 NQKVFSIKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELDIAI 255 N+K S + R + ++ +E+ +E + ENA+ + E+E E ++A+ Sbjct: 59 NEKELSYIQEWRSKAKAEIQPFREMRLEIKKRLENARDQEKEEEMEKELAM 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,830,634 Number of Sequences: 59808 Number of extensions: 212881 Number of successful extensions: 1209 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -