BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30308X (436 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 0.37 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 23 2.0 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 23 2.0 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 2.6 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 7.9 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 25.0 bits (52), Expect = 0.37 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 145 PEIKMTEDKEVTVETNGQEENAKTENSEDE 234 PEI+++++ +V T +EN KTE DE Sbjct: 298 PEIEISQN---SVSTGSDKENHKTEEPNDE 324 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 126 FNGKYLLISENKFIEASKL 70 F GK+ +S+N F E +K+ Sbjct: 2 FEGKFQFVSQNNFEEFAKV 20 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 126 FNGKYLLISENKFIEASKL 70 F GK+ +S+N F E +K+ Sbjct: 4 FEGKFQFVSQNNFEEFAKV 22 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 2.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +3 Query: 249 CDIRQVEYYFGDVNLHRDKFLQEQIKLD 332 C +++V + D + +KF + KLD Sbjct: 65 CMLKKVGFVNADTTFNEEKFRERTTKLD 92 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 401 ICVLCQFGKAIEFCEN 354 IC+L A++FC N Sbjct: 158 ICILKSITCALQFCHN 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,388 Number of Sequences: 438 Number of extensions: 2045 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -