BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30308X (436 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66100.1 68418.m08327 La domain-containing protein similar to... 59 1e-09 At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing ... 57 6e-09 At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing ... 57 6e-09 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 54 3e-08 At4g35890.1 68417.m05097 La domain-containing protein contains P... 46 1e-05 At2g43970.2 68415.m05468 La domain-containing protein contains P... 40 7e-04 At2g43970.1 68415.m05467 La domain-containing protein contains P... 40 7e-04 At1g79880.1 68414.m09333 La domain-containing protein contains P... 39 0.001 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 38 0.002 At3g19090.1 68416.m02426 RNA-binding protein, putative similar t... 37 0.005 At5g15430.1 68418.m01806 calmodulin-binding protein-related has ... 29 1.8 At3g13190.2 68416.m01651 myosin heavy chain-related contains wea... 29 1.8 At3g13190.1 68416.m01650 myosin heavy chain-related contains wea... 29 1.8 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 29 1.8 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 28 3.1 At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehy... 27 4.1 At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehy... 27 4.1 At1g53440.1 68414.m06057 leucine-rich repeat family protein / pr... 27 4.1 At1g31410.1 68414.m03847 putrescine-binding periplasmic protein-... 27 4.1 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 27 5.5 At3g13200.1 68416.m01652 Cwf15 / Cwc15 cell cycle control family... 27 5.5 At2g23700.1 68415.m02830 expressed protein contains Pfam profile... 27 5.5 At1g02730.1 68414.m00226 cellulose synthase family protein simil... 27 5.5 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 27 7.2 At4g04635.1 68417.m00678 hypothetical protein 27 7.2 At2g30100.1 68415.m03663 ubiquitin family protein low similarity... 27 7.2 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 27 7.2 At5g05490.2 68418.m00593 cohesion family protein SYN1, splice va... 26 9.5 At5g05490.1 68418.m00592 cohesion family protein SYN1, splice va... 26 9.5 At4g36030.1 68417.m05129 armadillo/beta-catenin repeat family pr... 26 9.5 At4g00238.1 68417.m00030 DNA-binding storekeeper protein-related... 26 9.5 At3g49410.1 68416.m05401 transcription factor-related contains w... 26 9.5 At3g17450.1 68416.m02228 hAT dimerisation domain-containing prot... 26 9.5 At2g07739.1 68415.m00990 expressed protein 26 9.5 >At5g66100.1 68418.m08327 La domain-containing protein similar to SP|P40796 La protein homolog (La ribonucleoprotein) (La autoantigen homolog) {Drosophila melanogaster}; contains Pfam profile PF05383: La domain Length = 453 Score = 59.3 bits (137), Expect = 1e-09 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 + QVEYYF NL RD+ L++Q+ D+GWVP+ ++ F RLA+LT + I AL S Sbjct: 340 LTQVEYYFSADNLSRDEHLRDQMN-DEGWVPVRVIAAFRRLAELTNNIQTILEALRSS 396 >At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 420 Score = 56.8 bits (131), Expect = 6e-09 Identities = 28/60 (46%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKST 431 IRQVEYYF D NL DKFL +K + G+VP+ + F+++ KLT D +I +AL +S+ Sbjct: 108 IRQVEYYFSDENLPTDKFLLNAMKRNKKGFVPISTIATFHKMKKLTRDHALIVSALKESS 167 >At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 422 Score = 56.8 bits (131), Expect = 6e-09 Identities = 28/60 (46%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKST 431 IRQVEYYF D NL DKFL +K + G+VP+ + F+++ KLT D +I +AL +S+ Sbjct: 108 IRQVEYYFSDENLPTDKFLLNAMKRNKKGFVPISTIATFHKMKKLTRDHALIVSALKESS 167 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 54.4 bits (125), Expect = 3e-08 Identities = 26/60 (43%), Positives = 36/60 (60%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKSTS 434 ++QVEYYF D NL D +L + ++GWVP +I+ F R+ +T D D I AL S S Sbjct: 283 LKQVEYYFSDENLENDHYLISLMD-EEGWVPTKIIAGFKRVKAMTMDVDFIVYALGFSNS 341 >At4g35890.1 68417.m05097 La domain-containing protein contains Pfam PF05383: La domain Length = 523 Score = 46.0 bits (104), Expect = 1e-05 Identities = 21/57 (36%), Positives = 37/57 (64%) Frame = +3 Query: 258 RQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 +Q++YYF D NL D +L+ + ++G+VPL ++ F ++A+LT++ I AL S Sbjct: 375 KQIQYYFSDENLITDIYLRGFMN-NEGFVPLRVVAGFKKVAELTDNIQQIVEALQNS 430 >At2g43970.2 68415.m05468 La domain-containing protein contains Pfam profile PF05383: La domain Length = 529 Score = 39.9 bits (89), Expect = 7e-04 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 + QVEYYF D+NL L I D +G+VP+ ++ F ++ + + +A L S Sbjct: 198 VNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINNNSQLAAVLQNS 256 >At2g43970.1 68415.m05467 La domain-containing protein contains Pfam profile PF05383: La domain Length = 545 Score = 39.9 bits (89), Expect = 7e-04 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 428 + QVEYYF D+NL L I D +G+VP+ ++ F ++ + + +A L S Sbjct: 198 VNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINNNSQLAAVLQNS 256 >At1g79880.1 68414.m09333 La domain-containing protein contains Pfam profile PF05383: La domain; similar to putative protein GB:CAA18589 [Arabidopsis thaliana] Length = 399 Score = 39.1 bits (87), Expect = 0.001 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQI-KLDDGWVPLEILTKFNRLAKL 386 + QVE+YF D NL D FL ++ K DG V L ++ F+R+ L Sbjct: 14 LTQVEFYFSDSNLPTDGFLNREVTKSKDGLVSLPLVCSFSRMRNL 58 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQI-KLDDGWVPLEILTKFNRL 377 +RQVE+YF D NL D FL++ + + +DG V L ++ F+++ Sbjct: 15 LRQVEFYFSDSNLPIDDFLKKTVTESEDGLVSLALICSFSKM 56 >At3g19090.1 68416.m02426 RNA-binding protein, putative similar to RNA-binding protein homolog GB:AAF00075 GI:6449448 from [Brassica napus]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 455 Score = 37.1 bits (82), Expect = 0.005 Identities = 17/60 (28%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKST 431 ++QVEY F D++L ++ + + I D +G+VP+ + ++ LT + +++ AL S+ Sbjct: 149 VKQVEYQFTDMSLLANESISKHISKDPEGYVPVSYIASTKKIKALTSNHHLVSLALRSSS 208 >At5g15430.1 68418.m01806 calmodulin-binding protein-related has weak similarity to calmodulin-binding proteins Length = 478 Score = 28.7 bits (61), Expect = 1.8 Identities = 10/42 (23%), Positives = 26/42 (61%) Frame = +1 Query: 145 PEIKMTEDKEVTVETNGQEENAKTENSEDETELDIAIFGKSN 270 P+ + ++DK +ET ++E+++ E E+E + ++++ N Sbjct: 293 PKSEKSQDKGECIETEHEDESSQEEEDEEEEDENVSVSEDKN 334 >At3g13190.2 68416.m01651 myosin heavy chain-related contains weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P05659) [Acanthamoeba castellanii] Length = 316 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 118 SIKESHRVIPEIKMTE-DKEVTVETNGQEENAKTENSEDETELDIAIF 258 +++++H + EI+ E D + + + ++AKT+ S E EL IA+F Sbjct: 137 NVEKAHSELKEIEQRERDHQAIEDLKKETKDAKTQLSLLEEELKIAVF 184 >At3g13190.1 68416.m01650 myosin heavy chain-related contains weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P05659) [Acanthamoeba castellanii] Length = 316 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 118 SIKESHRVIPEIKMTE-DKEVTVETNGQEENAKTENSEDETELDIAIF 258 +++++H + EI+ E D + + + ++AKT+ S E EL IA+F Sbjct: 137 NVEKAHSELKEIEQRERDHQAIEDLKKETKDAKTQLSLLEEELKIAVF 184 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 28.7 bits (61), Expect = 1.8 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Frame = +1 Query: 103 NQKVFSIKESHRVIPEIKM------TEDKEVTVETNGQEENAKTENSEDETELDIAI 255 N + S+ E + + E+K E KEV E Q E KTE +++E+ ++ A+ Sbjct: 6 NAQTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKEESPVEEAV 62 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 127 ESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 E + E + E + T T+G E + EN+E++TE Sbjct: 1817 EGENLAKEPAIDELMDATTTTDGDNEETEAENAEEKTE 1854 >At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.5 bits (58), Expect = 4.1 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANAL 419 ++ VE GD L+ D+ L++ L+ PL L L + D D++ N L Sbjct: 112 LKYVEARLGDRTLYADEILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGL 166 >At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.5 bits (58), Expect = 4.1 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 255 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANAL 419 ++ VE GD L+ D+ L++ L+ PL L L + D D++ N L Sbjct: 112 LKYVEARLGDRTLYADEILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGL 166 >At1g53440.1 68414.m06057 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1035 Score = 27.5 bits (58), Expect = 4.1 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 382 LARRLNFVRISNGTHPSSNFICSCR-NLSR-CRFTS 281 L R+ NFV S P+SN C C N S CR T+ Sbjct: 57 LDRKWNFVAESTSKLPTSNITCDCTFNASSVCRVTN 92 >At1g31410.1 68414.m03847 putrescine-binding periplasmic protein-related similar to Chain A, Putrescine Receptor (Potf) (GI:3891734) [Escherichia coli]; similar to Chain C, Putrescine Receptor (Potf) (GI:3891736) [Escherichia coli]; similar to Putrescine-binding periplasmic protein precursor. (Swiss-Prot:P31133) [Escherichia coli] Length = 524 Score = 27.5 bits (58), Expect = 4.1 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 130 SHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELDIAIFGKSNI 273 S R++P + + E+ ET EEN E++ E D + KS + Sbjct: 66 SARILPPPIVVTENEINTETVAGEENLNEVEDEEKLEADFEAY-KSKV 112 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 210 RVLLLSIGFNSYLFVLGHFDFWNNTMRFF 124 R+ L +GF ++LFV G +DF + +F Sbjct: 482 RLNTLELGFAAFLFVCGCYDFVHGKNNYF 510 >At3g13200.1 68416.m01652 Cwf15 / Cwc15 cell cycle control family protein contains Pfam profile PF04889: Cwf15/Cwc15 cell cycle control protein; similar to Cell cycle control protein cwf15 (Swiss-Prot:P78794) [Schizosaccharomyces pombe] Length = 230 Score = 27.1 bits (57), Expect = 5.5 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +1 Query: 136 RVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 R+IP +D +V ++++ ++ ++ ED+TE Sbjct: 102 RIIPRSVDADDSDVDIKSDDDSDDESDDDDEDDTE 136 >At2g23700.1 68415.m02830 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 707 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 161 PRTKR*LLKPMDKRRTRKPKIQKTKPNWILRYSASRIL 274 P T + +K ++ R+RK ++ T N++ RY +R L Sbjct: 668 PETMKKTIKKLNSGRSRKSIVEWTPHNFVFRYLIAREL 705 >At1g02730.1 68414.m00226 cellulose synthase family protein similar to cellulose synthase catalytic subunit [gi:13925881] from Nicotiana alata, cellulose synthase-4 [gi:9622880] from Zea mays Length = 1181 Score = 27.1 bits (57), Expect = 5.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 145 PEIKMTEDKEVTVETNGQEENAKTENSEDETELDIAIFGKSN 270 P+ M +D EV++ NG+ + ++ + E+ L FG SN Sbjct: 768 PKAMMKKDDEVSLPINGEYNEEENDDGDIESLLLPKRFGNSN 809 >At5g17760.1 68418.m02082 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 505 Score = 26.6 bits (56), Expect = 7.2 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +1 Query: 133 HRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETELDIAIFGKSNII 276 HR+ PEI+ D EV EE K+E++ D+A+ G N++ Sbjct: 412 HRLFPEIERLIDGEVMTPAQVAEELMKSEDA------DVALEGLVNVL 453 >At4g04635.1 68417.m00678 hypothetical protein Length = 284 Score = 26.6 bits (56), Expect = 7.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 121 IKESHRVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 ++E H + E +D+E E G+EE + E E+E E Sbjct: 208 VEEDHHI--EEYHVDDEEEEEEEEGEEEEGEGEEEEEEEE 245 >At2g30100.1 68415.m03663 ubiquitin family protein low similarity to SP|Q9UQ13 Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01535: PPR repeat, PF00560: Leucine Rich Repeat Length = 897 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 412 FAMTSVSSVSLARRLNFVRISNGTHPSSNFICSCR-NLSRCRF 287 FA ++S++SL R L + ++ P+S IC+ + N S +F Sbjct: 7 FASLTISTISLRRFLPRLHRNHSVKPNSRIICNLKLNYSAGKF 49 >At1g17790.1 68414.m02202 DNA-binding bromodomain-containing protein similar to SP|P13709 Female sterile homeotic protein (Fragile-chorion membrane protein) {Drosophila melanogaster}; contains Pfam profile PF00439: Bromodomain Length = 487 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 103 NQKVFSIKESHRVIPEIK-MTEDKEVTVETNGQEENAKTENSEDETELDI 249 N + +++E R+ E++ + DK TV ++ N + +DE ELDI Sbjct: 326 NNRDLTLEEKRRLSEELQDLPYDKLETVVQIIKKSNPELSQKDDEIELDI 375 >At5g05490.2 68418.m00593 cohesion family protein SYN1, splice variant 1 (SYN1) identical to SYN1 splice variant 1 [Arabidopsis thaliana] GI:6453715 Length = 617 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 139 VIPEIKMTEDKEVTVETNGQEENAKTENSEDETELD 246 ++PE + T DKE+ ET + N DE D Sbjct: 514 MLPEKRFTADKEILFETASTQTQKPVCNQSDEMITD 549 >At5g05490.1 68418.m00592 cohesion family protein SYN1, splice variant 1 (SYN1) identical to SYN1 splice variant 1 [Arabidopsis thaliana] GI:6453715 Length = 627 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 139 VIPEIKMTEDKEVTVETNGQEENAKTENSEDETELD 246 ++PE + T DKE+ ET + N DE D Sbjct: 524 MLPEKRFTADKEILFETASTQTQKPVCNQSDEMITD 559 >At4g36030.1 68417.m05129 armadillo/beta-catenin repeat family protein contains Pfam profile: PF00514 armadillo/beta-catenin-like repeat Length = 670 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 49 LALPCIS*LRSLNKLVF*NQKVFSIKESHRVIPEIKMTEDKE 174 L +PC+ RS+ L + F E+H ++P +K+ +D E Sbjct: 518 LLIPCV---RSIGNLA----RTFKSAETHMIVPLVKLLDDGE 552 >At4g00238.1 68417.m00030 DNA-binding storekeeper protein-related contains Pfam PF04504: Protein of unknown function, DUF573; similar to storekeeper protein GI:14268476 [Solanum tuberosum] Length = 345 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 145 PEIKMTEDKEVTVETNGQEENAKTENSEDE 234 P K +D+ V V+ N +E+N K EDE Sbjct: 237 PVKKKVKDESVLVKANSKEKNVKPLVKEDE 266 >At3g49410.1 68416.m05401 transcription factor-related contains weak similarity to transcription factor IIIC63 (GI:5281316) [Homo sapiens] Length = 559 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +1 Query: 157 MTEDKEVTVETNGQEENA--KTENSEDETELDIA 252 + E+ + V +G++EN + E+ E+E ELD+A Sbjct: 446 VNENVDANVNEDGEDENLDDEDEDEEEEEELDMA 479 >At3g17450.1 68416.m02228 hAT dimerisation domain-containing protein contains Pfam profile PF04937: Protein of unknown function (DUF 659) Length = 877 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 136 RVIPEIKMTEDKEVTVETNGQEENAKTENSEDETE 240 R++P+ +T +KE +G++ K ++ +DE E Sbjct: 813 RLLPDWLVTSEKEEEEALHGEDRAEKEDHEDDEEE 847 >At2g07739.1 68415.m00990 expressed protein Length = 199 Score = 26.2 bits (55), Expect = 9.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 171 FVLGHFDFWNNTMRFFN 121 ++L HF FWNN FF+ Sbjct: 100 YLLFHFFFWNNHKHFFD 116 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,362,919 Number of Sequences: 28952 Number of extensions: 156995 Number of successful extensions: 708 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -