BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30305 (441 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 1.3 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 6.9 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.0 bits (47), Expect = 1.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 230 IAKCVNITILRFYYIIKTLSVVMCNVK*NVLKLLTMRLKL 349 I CV I I YY+ V V N+L+L+ R ++ Sbjct: 255 IKNCV-IVIFELYYLSHVCQNVSTEVIGNILRLMHRRFEI 293 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 185 KKR*WWTVTVF 153 KKR +W VT+F Sbjct: 134 KKRSFWAVTIF 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,551 Number of Sequences: 336 Number of extensions: 1643 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9880622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -