SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30305
         (441 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    23   1.3  
AM292341-1|CAL23153.2|  393|Tribolium castaneum gustatory recept...    21   6.9  

>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 23.0 bits (47), Expect = 1.3
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +2

Query: 230 IAKCVNITILRFYYIIKTLSVVMCNVK*NVLKLLTMRLKL 349
           I  CV I I   YY+      V   V  N+L+L+  R ++
Sbjct: 255 IKNCV-IVIFELYYLSHVCQNVSTEVIGNILRLMHRRFEI 293


>AM292341-1|CAL23153.2|  393|Tribolium castaneum gustatory receptor
           candidate 20 protein.
          Length = 393

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -2

Query: 185 KKR*WWTVTVF 153
           KKR +W VT+F
Sbjct: 134 KKRSFWAVTIF 144


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,551
Number of Sequences: 336
Number of extensions: 1643
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used:  9880622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -