BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30305 (441 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39521| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_55658| Best HMM Match : Calx-beta (HMM E-Value=0.05) 27 9.1 SB_46345| Best HMM Match : AAA_5 (HMM E-Value=0.053) 27 9.1 SB_37520| Best HMM Match : Calx-beta (HMM E-Value=0.023) 27 9.1 SB_15750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 9.1 SB_50735| Best HMM Match : Calx-beta (HMM E-Value=0.023) 27 9.1 SB_40013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_29908| Best HMM Match : Calx-beta (HMM E-Value=2.3e-08) 27 9.1 SB_29729| Best HMM Match : Ank (HMM E-Value=0.0055) 27 9.1 >SB_39521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.9 bits (64), Expect = 0.97 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -1 Query: 366 HHTSYINFNLIVNNLSTFYLTLHITTLSVLII 271 HH YI +I+ ++ FYLT+ +T + ++I+ Sbjct: 33 HHHHYIIIIIILTSIIHFYLTVTVTVIVIVIV 64 >SB_55658| Best HMM Match : Calx-beta (HMM E-Value=0.05) Length = 203 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 110 TVYITDDFVVEPNKTFYLTLNITDPAV 136 >SB_46345| Best HMM Match : AAA_5 (HMM E-Value=0.053) Length = 636 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -1 Query: 396 NRRRAEHKMNHHTSYINFNLIVNNLSTFYLTLHITTLSVLII**NRKIVI 247 +R+ +EH N+H + +I+ + +T+ IT + II + I+I Sbjct: 72 SRKSSEHNYNNHQHIMVITIIIITIIIMIITITITINHITIINNHINIII 121 >SB_37520| Best HMM Match : Calx-beta (HMM E-Value=0.023) Length = 139 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 95 TVYITDDFVVEPNKTFYLTLNITDPAV 121 >SB_15750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 294 TVYITDDFVVEPNKTFYLTLNITDPAV 320 >SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 753 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 245 TVYITDDFVVEPNKTFYLTLNITDPAV 271 >SB_50735| Best HMM Match : Calx-beta (HMM E-Value=0.023) Length = 141 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 95 TVYITDDFVVEPNKTFYLTLNITDPAV 121 >SB_40013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 268 TVYITDDFVVEPNKTFYLTLNITDPAV 294 >SB_29908| Best HMM Match : Calx-beta (HMM E-Value=2.3e-08) Length = 549 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 505 TVYITDDFVVEPNKTFYLTLNITDPAV 531 >SB_29729| Best HMM Match : Ank (HMM E-Value=0.0055) Length = 222 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 360 TSYINFNLIVNNLSTFYLTLHITTLSV 280 T YI + +V TFYLTL+IT +V Sbjct: 34 TVYITDDFVVEPNKTFYLTLNITDPAV 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,330,225 Number of Sequences: 59808 Number of extensions: 185915 Number of successful extensions: 324 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -