BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30305 (441 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72570.1 68414.m08392 ovule development protein, putative sim... 26 9.8 >At1g72570.1 68414.m08392 ovule development protein, putative similar to ovule development protein AINTEGUMENTA (GI:1209099) [Arabidopsis thaliana];contains Pfam profile: PF00847 AP2 domain (2 copies); contains non-consensus TA acceptor splice site at exon 4 Length = 425 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 399 ANRRRAEHKMNHHTSYINFNLIVNNLSTFYLTLHITTL 286 +N + E+ +NH+ + +N +VN L+ LH T+ Sbjct: 64 SNSHQTEYPINHNQTNVNCTTVVNRLNPPGYLLHDQTV 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,735,005 Number of Sequences: 28952 Number of extensions: 119994 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 246 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -