BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30304 (809 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein p... 63 9e-12 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 27 0.90 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 25 2.8 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 4.8 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 24 4.8 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 24 4.8 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 8.4 >AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein protein. Length = 234 Score = 63.3 bits (147), Expect = 9e-12 Identities = 31/83 (37%), Positives = 46/83 (55%) Frame = +3 Query: 255 RQIVETARSEASNYRSQYGSPVPLKYLNERVSMYMHAYTLYSAVRPYGCSVVMGTWTDYE 434 R +V+ AR A NY Y P+P L ++V+ M YT VRP+G S+++ W D Sbjct: 84 RLLVKQARKLAQNYYLTYREPIPTSQLVQKVATVMQEYTQSGGVRPFGVSLLICGWDDGR 143 Query: 435 GPQMYMLDPSGVSFSYFGCAVGK 503 P ++ DPSG F++ A+GK Sbjct: 144 -PYLFQCDPSGAYFAWKATAMGK 165 Score = 56.4 bits (130), Expect = 1e-09 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 3/95 (3%) Frame = +1 Query: 22 YDLSASQFSPDGRVFQVEYAAKAVENSGTVIGLRGKDGVVFAVEKLITSKLYEPGANKRI 201 Y S + FSP G++ Q+EYA AV +G++ +GVV A E S LY+ + ++ Sbjct: 6 YSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKAVNGVVIATENKQKSILYDEHSVHKV 65 Query: 202 FHIDEHVGMAVAGLISD---ADKLSRLLVQRHQTT 297 + H+GM +G+ D K +R L Q + T Sbjct: 66 EMVTNHIGMIYSGMGPDYRLLVKQARKLAQNYYLT 100 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.6 bits (56), Expect = 0.90 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = +2 Query: 554 TVKELVREAARIIYLVHDELKDKQFELELSWVSKDTKGRHELVPRELATEAENQAKQALA 733 ++ E + EA R + L E++++ + + G ELVP LA A N+A + Sbjct: 1037 SLPEDMAEAERRL-LRRREVRNRSAQRRRQQQRQQRLGDFELVPAVLARAAANEAAEPTG 1095 Query: 734 DIEDSD 751 ++E+ + Sbjct: 1096 EVEEEE 1101 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 25.0 bits (52), Expect = 2.8 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +3 Query: 333 LNERVSMYMHAYTLYSAVRPYGCSVVMGTWTDYEGP 440 L++ + Y HA + G ++ G W D+E P Sbjct: 293 LSQMFAFYWHANEVLEQSLGIGDAIYNGAWPDFEEP 328 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 5 VLSELAMTYRLLNFLLMVAFSKWNMLQRL 91 VL+ +MTY +L FLL+ + + +L R+ Sbjct: 32 VLASPSMTYCVLFFLLLTVYIAFILLNRI 60 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 134 GWYLLLRS*SHPNCMNLAQTR 196 GW +LL + + P+C NL R Sbjct: 15 GWMMLLATAADPDCENLKNRR 35 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 134 GWYLLLRS*SHPNCMNLAQTR 196 GW +LL + + P+C NL R Sbjct: 15 GWMMLLATAADPDCENLKNRR 35 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 808 FFHFIRNLILRLIMFNLSFI 749 F+ NL+L LI NLSFI Sbjct: 221 FYPICLNLLLALIASNLSFI 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,067 Number of Sequences: 2352 Number of extensions: 16687 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -