BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30304 (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 27 0.16 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 25 0.83 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 7.7 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 7.7 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 22 7.7 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 27.5 bits (58), Expect = 0.16 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 545 GDLTVKELVREAARIIYLVHDELKDKQFELELSWVSKDTKGRHELVPRELAT-EAENQAK 721 GD T+ E V + + I H E+ DKQ E + + + + ++ L T E N+++ Sbjct: 1073 GDCTMAEDVYQTLKHIIQTHGEMTDKQVEAYMLSLRDENRYHEDIFGITLRTAEVHNRSR 1132 Query: 722 Q 724 + Sbjct: 1133 E 1133 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 25.0 bits (52), Expect = 0.83 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 390 PYGCSVVMGTWTDYEGPQMY 449 P GC+VV+GT+ + P +Y Sbjct: 435 PAGCTVVIGTFKLHRQPHIY 454 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 7.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 218 CSSIWNILLFAPGSYNLDVINFS 150 C SIW + + A YN+ V S Sbjct: 137 CGSIWTMTMIAFDRYNVIVKGLS 159 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 218 CSSIWNILLFAPGSYNLDVINFS 150 C SIW + + A YN+ V S Sbjct: 103 CGSIWTMTMIAFDRYNVIVKGLS 125 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.8 bits (44), Expect = 7.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 218 CSSIWNILLFAPGSYNLDVINFS 150 C SIW + + A YN+ V S Sbjct: 13 CGSIWTMTMIAFDRYNVIVKGLS 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,260 Number of Sequences: 438 Number of extensions: 4543 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -