BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30303 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) 88 7e-18 SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) 67 1e-11 SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) 66 3e-11 SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) 56 4e-08 SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) 46 4e-05 SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) 44 9e-05 SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) 43 3e-04 SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) 42 5e-04 SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) 39 0.003 SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) 38 0.006 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) 36 0.024 SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 32 0.52 SB_24458| Best HMM Match : P60 (HMM E-Value=0.00014) 31 0.68 SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) 31 1.2 SB_30182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14838| Best HMM Match : T4_deiodinase (HMM E-Value=0) 29 4.8 SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) 28 8.4 >SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 1056 Score = 87.8 bits (208), Expect = 7e-18 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 1/93 (1%) Frame = +1 Query: 268 KGDKPVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIPE-NDGPVKVA 444 K + V DA G+KF+M +FS+++ F +D G L+P +KSE +PE NDGPVKV Sbjct: 809 KANPSAVVYNDA-GDKFLMKEKFSVDSFKQFLEDYFAGSLKPHIKSEPLPESNDGPVKVV 867 Query: 445 VGKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 VG+NFKE+V D +D LIEFY +SL P Sbjct: 868 VGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEP 900 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSG 647 PWCGHC+ L P + ELGEKL+D +++ I K+DATAND P + F V G Sbjct: 890 PWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPPN-FSVQG 935 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 3/53 (5%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK--DEEVDIIKIDAT-ANDWPKSQFDVSGFPTI 659 PWCGHC++LAP +E E LK D V + K+D T A S++ VSG+PT+ Sbjct: 565 PWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTL 617 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/42 (47%), Positives = 24/42 (57%) Frame = +3 Query: 21 LKAFIKENYHGLVGVRQKDNIHDFSNPLIVAYYDVDYTKNPK 146 +K FI HG VG R DN F PL V ++DVD+ KN K Sbjct: 744 IKKFINAKAHGRVGQRTPDNEEQFPKPLCVVFFDVDWKKNAK 785 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 648 FPTIFWKPKDSSKKPQRY 701 FPTI+W P ++ + P++Y Sbjct: 981 FPTIYWAPANNKENPEKY 998 >SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 295 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEK-LKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 PWCGHC++LAP +E+LGE + +V I K+DA + S+FDV GFPTI + PK S+ Sbjct: 49 PWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGST- 107 Query: 687 KPQRY 701 P+ Y Sbjct: 108 TPEEY 112 >SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 536 Score = 66.1 bits (154), Expect = 3e-11 Identities = 28/57 (49%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDE-EVDIIKIDATANDWPKSQFDVSGFPTIFWKPKD 677 PWCGHC++LAP+W++LGEK KD ++ + K+D+TAN+ V FPTI + PK+ Sbjct: 412 PWCGHCKQLAPIWDQLGEKYKDHADIVVAKMDSTANE--VEGVKVHSFPTIKYFPKE 466 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDE--EVDIIKIDATANDWPKSQFDVSGFPTI-FWK 668 PWCGHC+ LAP + + +LK E E+ + K+DATA +F V G+PTI F+K Sbjct: 51 PWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFFK 106 Score = 54.8 bits (126), Expect = 6e-08 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 3/85 (3%) Frame = +1 Query: 298 DADGNKFV-MSAEFSIENLLTFTKDLLDGKLEPFVKSEAIPEN--DGPVKVAVGKNFKEL 468 D D K+ +AE + EN+ F + LD KL+P + S IPE+ PVKV GKNF E+ Sbjct: 338 DDDMTKYKPTAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEV 397 Query: 469 VTDSNRDALIEFYGHGADTVRSLLP 543 + +++ +EFY + L P Sbjct: 398 ARNKDKNVFVEFYAPWCGHCKQLAP 422 >SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 64.9 bits (151), Expect = 6e-11 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 4/83 (4%) Frame = +1 Query: 271 GDKPVVAGRDADGNKFVMSA---EFSIENLLTFTKDLLDGKLEPFVKSEAIPE-NDGPVK 438 G++ V D +G KF M EFS ++L F ++ G L+P +KS+ +P+ N PV Sbjct: 469 GEEVNVGCFDKEGRKFRMDPDEEEFSEDSLREFVEEFKAGNLKPIIKSQPVPKSNKEPVT 528 Query: 439 VAVGKNFKELVTDSNRDALIEFY 507 V VGK F E+V D +D LIEFY Sbjct: 529 VVVGKTFDEIVNDPKKDVLIEFY 551 Score = 54.8 bits (126), Expect = 6e-08 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK--DEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCGHC+ LAP + + +K+K D V K+DAT +FDVSG+PT+ Sbjct: 88 PWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTL 139 Score = 54.4 bits (125), Expect = 8e-08 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 PWCG L P +++LG+ + D+ + I KIDATAND P S + V GFPTI++ K Sbjct: 553 PWCGIA--LEPTFKKLGKHFRNDKNIVIAKIDATANDVP-STYAVEGFPTIYFATSKDKK 609 Query: 687 KPQRY 701 P ++ Sbjct: 610 NPIKF 614 Score = 53.6 bits (123), Expect = 1e-07 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 4/67 (5%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK--DEEVDIIKIDATANDWPKSQFDVSGFPT--IFWKPKD 677 PWCGHC++LAP +E+ ++L+ D + + +DAT +++V G+PT +F K K Sbjct: 203 PWCGHCKQLAPEYEKAAQELQKHDPPIPLAIVDATIESELAQKYEVQGYPTLKVFRKGKA 262 Query: 678 SSKKPQR 698 + K QR Sbjct: 263 TEYKGQR 269 Score = 39.5 bits (88), Expect = 0.003 Identities = 13/35 (37%), Positives = 27/35 (77%) Frame = +2 Query: 149 TNYWRNRVLKVAKEQTEATFAVSDKDDFTHELNEF 253 T +WR++V++VAK+ + TFA++++++ EL +F Sbjct: 429 TQFWRSKVIEVAKDHRDITFAIANEEESEQELKDF 463 >SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 362 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCGHCQ+LAP W + +LK +V + +DAT + S++ V G+PTI Sbjct: 107 PWCGHCQRLAPEWAKAATELKG-KVKVGALDATVHTVTASRYQVQGYPTI 155 >SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) Length = 386 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVD--IIKIDATANDWPKSQFDVSGFPT 656 PWCGHC+ + P + + + LK++E+ + +DAT +F V G+PT Sbjct: 109 PWCGHCKAMKPEYVDAAQTLKEQEIPGVLAAVDATKEAALGKRFKVEGYPT 159 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDE 578 PWCGHC+K P + KD+ Sbjct: 222 PWCGHCKKAKPELMSAAKHHKDK 244 >SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) Length = 186 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDE-EVDIIKID 602 PWC HC KLAP+WE L E KD ++ I KI+ Sbjct: 116 PWCIHCIKLAPIWERLAEDFKDNADITISKIN 147 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +3 Query: 534 LAPVWEELGEKLKDEEVD--IIKIDATANDWPKSQFDVSGFPTI 659 + P WE LGE+ E+ D I K+D T++ + ++ +PT+ Sbjct: 1 MMPAWEALGEQYSKEKRDLTIAKVDCTSDVNLCVKQNIRAYPTM 44 >SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) Length = 271 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDII-KIDATANDWPKSQFDVSGFPTI 659 PWCGHC+ P +E+ E KD+ + K+D T + +V+G+PT+ Sbjct: 174 PWCGHCKNAKPKYEKAAETFKDQPNRVFAKLDCTKFGDVCDKEEVNGYPTL 224 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 3/62 (4%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEV--DIIKIDATANDWPKSQFDVSGFPTI-FWKPKDS 680 PWCGHC ++ P + + + L DE+ ++ +D T + + ++G+PT+ +K ++ Sbjct: 77 PWCGHCNEMKPNYYKAAQVLHDEDANCNLAAVDCTKHKDVAKKVALAGYPTVKLYKASNT 136 Query: 681 SK 686 +K Sbjct: 137 AK 138 >SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) Length = 975 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 4/62 (6%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKP---KD 677 PWCG C APV + +D +V + +IDA ND P + VS +P+I P KD Sbjct: 545 PWCGMCINFAPVLLAVARFFQDISQVSVTRIDADQNDLPWN-LTVSSYPSIILFPAGRKD 603 Query: 678 SS 683 SS Sbjct: 604 SS 605 >SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) Length = 472 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 7/58 (12%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEK---LKDEEVDIIKIDATANDWPK----SQFDVSGFPTIF 662 PWC HC+K+AP ++++ ++ L V + K+D +AN+ +++V PTI+ Sbjct: 161 PWCFHCKKMAPDYKDVAKELLILSHNSVRLAKVDCSANNMATKKTCKKYNVKFLPTIY 218 Score = 30.7 bits (66), Expect = 1.2 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD 575 PWC CQ+L+P+++ +L+D Sbjct: 78 PWCSDCQRLSPLFDTAALQLRD 99 >SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) Length = 70 Score = 38.3 bits (85), Expect = 0.006 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEE 581 PWCGHC++LAP +E E LK + Sbjct: 40 PWCGHCKRLAPEYETAAEALKKND 63 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCG C + AP +E+L + LK +V K++ + S+ ++ +PT+ Sbjct: 461 PWCGPCMRFAPKYEQLAKMLKG-KVRAAKVNCEQDYGLCSEANIHSYPTV 509 >SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) Length = 308 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI-FWKPK 674 WCG C+ +APV+ L EK K + +KID ++ V+ PT F+K K Sbjct: 38 WCGPCKSIAPVYSGLSEKYK--QAVFLKIDVDVCQELAAKQGVTAMPTFQFFKNK 90 >SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 31.9 bits (69), Expect = 0.52 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEV-DIIKIDATANDWPKSQ-----FDVSGFPTI 659 PWC HCQ+L P E L + + K+D T P+S+ F + G+P++ Sbjct: 47 PWCHHCQELLPQLEGAANALAAKGLFQFAKVDCTD---PRSKVLCDNFKIEGYPSV 99 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT 656 WCG C+ +APV+ L K D V +K+D + PT Sbjct: 39 WCGPCKSIAPVFTNLSMKFMD--VVFLKVDVDQCQLTAESCGIRAMPT 84 >SB_24458| Best HMM Match : P60 (HMM E-Value=0.00014) Length = 351 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 540 PVWEE-LGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSKK 689 P WEE +GE L D++ D K+D +D ++ +V P + K K S +K Sbjct: 209 PTWEEEMGEGLFDDKSDDDKVDDDDDDDEDNEEEVMNGPILRSKQKTSQQK 259 >SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) Length = 438 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATAN 614 WCG C+ + P +EE+ ++ K V K+D N Sbjct: 22 WCGPCRMIGPKFEEMAKEFKG--VKCAKVDVDVN 53 >SB_30182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 128 LYQEPEGTNYWRNRVLKVAKEQTEATFAVSDKDD 229 LY + E T+YWR+R + V K+ F V ++D Sbjct: 185 LYYKTEMTSYWRSRKISVMKKLRSFRFKVKYRND 218 >SB_14838| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 194 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 256 IDFAKGDKPVVAGRDADGNKFVMSAEFSIENLLTFTKDLLD 378 +DFAKGD+P+V + M E ++ KD+ D Sbjct: 50 LDFAKGDRPLVVNFGSSTCPIFMKKMLEYEKMIVQFKDVAD 90 >SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 WC C+ L P + + + +D +VD+ K+D F V+ PT+ Sbjct: 2 WCNPCKVLTPRLDAIIAE-QDGKVDLAKVDIDVMGELAFNFGVNAVPTV 49 >SB_2654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 WC C+ L P + + + +D +VD+ K+D F V+ PT+ Sbjct: 48 WCNPCKVLTPRLDAIIAE-QDGKVDLAKVDIDVMGELAFNFGVNAVPTV 95 >SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) Length = 335 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDII 593 PW HCQ++ +++++ ++ D + DI+ Sbjct: 53 PWDDHCQRILQIFDQVADEFADRD-DIV 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,577,442 Number of Sequences: 59808 Number of extensions: 361139 Number of successful extensions: 1352 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1340 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -