BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30303 (701 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 40 8e-05 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 26 1.3 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 25 3.0 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 25 3.0 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 25 3.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 9.3 AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. 23 9.3 AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. 23 9.3 AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. 23 9.3 AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. 23 9.3 AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. 23 9.3 AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. 23 9.3 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 39.9 bits (89), Expect = 8e-05 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT-IFWKPKD 677 WCG C+ +AP EE K D+ V ++K+D + +Q++++ PT +F K K+ Sbjct: 31 WCGPCKVIAPKLEEFQNKYADKIV-VVKVDVDECEELAAQYNIASMPTFLFIKRKE 85 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 30 FIKENYHGLVGVRQKDNIHDFSNPLIVAYYDVDYTKNPKA 149 F+++ Y VR K+N +F +P++V D D +P + Sbjct: 625 FVQKRYE----VRLKENAFEFESPIVVEARDSDLEGSPNS 660 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 24.6 bits (51), Expect = 3.0 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 364 KDLLDGKLEPFVKSEAIPENDGPVK--VAVGKNFKELVTDSNRDALIEFYGH 513 KDLL+ K+ + PE DGP + +A + + D N D+ Y H Sbjct: 270 KDLLEEKIMYSHLVDYFPEYDGPQRDAIAAREFILRMFVDLNPDSEKIIYSH 321 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 24.6 bits (51), Expect = 3.0 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 364 KDLLDGKLEPFVKSEAIPENDGPVK--VAVGKNFKELVTDSNRDALIEFYGH 513 KDLL+ K+ + PE DGP + +A + + D N D+ Y H Sbjct: 83 KDLLEEKIMYSHLVDYFPEYDGPQRDAIAAREFILRMFVDLNPDSEKIIYSH 134 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 24.6 bits (51), Expect = 3.0 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 364 KDLLDGKLEPFVKSEAIPENDGPVK--VAVGKNFKELVTDSNRDALIEFYGH 513 KDLL+ K+ + PE DGP + +A + + D N D+ Y H Sbjct: 84 KDLLEEKIMYSHLVDYFPEYDGPQRDAIAAREFILRMFVDLNPDSEKIIYSH 135 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 9.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 619 GPNHNSTFPASPQSSGSLRTAPRNLRD 699 GPNH+S + SSGS T+ + RD Sbjct: 1525 GPNHSSPSNHTDDSSGS--TSAKQYRD 1549 >AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 195 VCSLATLRTRFLQ*LVP 145 VCSL TL TRF+ P Sbjct: 47 VCSLRTLLTRFMDITTP 63 >AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 195 VCSLATLRTRFLQ*LVP 145 VCSL TL TRF+ P Sbjct: 47 VCSLRTLLTRFMDITTP 63 >AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 195 VCSLATLRTRFLQ*LVP 145 VCSL TL TRF+ P Sbjct: 47 VCSLRTLLTRFMDITTP 63 >AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 195 VCSLATLRTRFLQ*LVP 145 VCSL TL TRF+ P Sbjct: 47 VCSLRTLLTRFMDITTP 63 >AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 195 VCSLATLRTRFLQ*LVP 145 VCSL TL TRF+ P Sbjct: 47 VCSLRTLLTRFMDITTP 63 >AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 195 VCSLATLRTRFLQ*LVP 145 VCSL TL TRF+ P Sbjct: 47 VCSLRTLLTRFMDITTP 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,167 Number of Sequences: 2352 Number of extensions: 11459 Number of successful extensions: 94 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -