BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30303 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 78 5e-15 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 78 5e-15 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 76 3e-14 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 73 2e-13 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 66 3e-11 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 66 3e-11 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 66 3e-11 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 66 3e-11 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 56 2e-08 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 52 5e-07 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 49 3e-06 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 49 3e-06 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 49 3e-06 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 48 6e-06 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 47 1e-05 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 43 2e-04 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 42 4e-04 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 41 0.001 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 39 0.003 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 38 0.005 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 38 0.005 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 38 0.005 At3g62510.1 68416.m07023 protein disulfide isomerase-related con... 36 0.026 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 36 0.034 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 35 0.060 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 34 0.079 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 34 0.079 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 34 0.079 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 34 0.10 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 34 0.10 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 33 0.18 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 33 0.24 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 33 0.24 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 33 0.24 At2g26190.1 68415.m03145 calmodulin-binding family protein conta... 33 0.24 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 33 0.24 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 32 0.32 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 32 0.32 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 31 0.98 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 31 0.98 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 31 0.98 At4g16745.1 68417.m02529 exostosin family protein contains Pfam ... 29 2.3 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 29 2.3 At4g20770.1 68417.m03016 pentatricopeptide (PPR) repeat-containi... 29 3.0 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 29 3.0 At1g33790.1 68414.m04177 jacalin lectin family protein similar t... 29 3.0 At4g32790.1 68417.m04665 exostosin family protein contains Pfam ... 29 3.9 At5g19670.1 68418.m02340 exostosin family protein contains Pfam ... 28 6.9 At4g37590.1 68417.m05320 phototropic-responsive NPH3 family prot... 28 6.9 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 28 6.9 At5g25820.1 68418.m03064 exostosin family protein contains Pfam ... 27 9.1 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 78.2 bits (184), Expect = 5e-15 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPTIFWK 668 PWCGHCQKLAP+ +E+ + D V I K+DATAND+PK FDV GFPTI++K Sbjct: 402 PWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFK 455 Score = 58.4 bits (135), Expect = 4e-09 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = +1 Query: 280 PVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIP-ENDGPVKVAVGKN 456 P++ + AD K+ + ++ + ++ KD DGK+ P KS+ IP EN+ PVKV V + Sbjct: 325 PLIIIQTADDKKY-LKTNVEVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDS 383 Query: 457 FKELVTDSNRDALIEFYGHGADTVRSLLP 543 ++V +S ++ L+EFY + L P Sbjct: 384 LDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDE--EVDIIKIDAT--ANDWPKSQFDVSGFPTI 659 PWCGHC++LAP +E+ L V + KIDA+ N +Q++V GFPTI Sbjct: 57 PWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTI 110 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 78.2 bits (184), Expect = 5e-15 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPTIFWK 668 PWCGHCQKLAP+ +E+ + D V I K+DATAND+PK FDV GFPTI++K Sbjct: 402 PWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFK 455 Score = 58.4 bits (135), Expect = 4e-09 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = +1 Query: 280 PVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIP-ENDGPVKVAVGKN 456 P++ + AD K+ + ++ + ++ KD DGK+ P KS+ IP EN+ PVKV V + Sbjct: 325 PLIIIQTADDKKY-LKTNVEVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDS 383 Query: 457 FKELVTDSNRDALIEFYGHGADTVRSLLP 543 ++V +S ++ L+EFY + L P Sbjct: 384 LDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDE--EVDIIKIDAT--ANDWPKSQFDVSGFPTI 659 PWCGHC++LAP +E+ L V + KIDA+ N +Q++V GFPTI Sbjct: 57 PWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTI 110 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 75.8 bits (178), Expect = 3e-14 Identities = 37/90 (41%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +1 Query: 277 KPVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIPE-NDGPVKVAVGK 453 K +V + D KF++ E ++ N+ T +D L KL+PF KS+ +PE NDG VKV VG Sbjct: 386 KVLVYTGNEDMRKFILDGELTVNNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGN 445 Query: 454 NFKELVTDSNRDALIEFYGHGADTVRSLLP 543 NF E+V D ++D L+E Y +S P Sbjct: 446 NFDEIVLDESKDVLLEIYAPWCGHCQSFEP 475 Score = 58.0 bits (134), Expect = 6e-09 Identities = 24/55 (43%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKP 671 PWCGHCQ P++ +LG+ LK + + + K+D T+N+ P+++ D GFPTI + P Sbjct: 465 PWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNEHPRAKAD--GFPTILFFP 517 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/51 (39%), Positives = 28/51 (54%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIF 662 PWCG CQ L P + +LK + KIDAT ++++ GFPT+F Sbjct: 126 PWCGACQALTPEYAAAATELKGLAA-LAKIDATEEGDLAQKYEIQGFPTVF 175 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 72.9 bits (171), Expect = 2e-13 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPTIFWK 668 PWCGHCQKLAP+ +E+ + D V I K+DATAND P FDV GFPTI+++ Sbjct: 400 PWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFR 453 Score = 52.4 bits (120), Expect = 3e-07 Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 1/89 (1%) Frame = +1 Query: 280 PVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIP-ENDGPVKVAVGKN 456 P++ + D K+ + ++ + ++ KD DGK+ KS+ IP EN+ PVKV V ++ Sbjct: 323 PLIIIQTPDNKKY-LKVNVEVDQIESWFKDFQDGKVAVHKKSQPIPAENNEPVKVVVAES 381 Query: 457 FKELVTDSNRDALIEFYGHGADTVRSLLP 543 ++V S ++ LIEFY + L P Sbjct: 382 LDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 4/54 (7%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEE--VDIIKIDAT--ANDWPKSQFDVSGFPTI 659 PWCGHCQKLAP +E+ +L + + KIDA+ AN +++ + GFPT+ Sbjct: 56 PWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTL 109 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 65.7 bits (153), Expect = 3e-11 Identities = 34/92 (36%), Positives = 50/92 (54%), Gaps = 1/92 (1%) Frame = +1 Query: 271 GDKPVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIPE-NDGPVKVAV 447 G K + + D K+ E + + F +D L+ KL+PF KS+ IPE ND VK+ V Sbjct: 388 GPKLIGYTGNEDPKKYFFDGEIQSDKIKIFGEDFLNDKLKPFYKSDPIPEKNDEDVKIVV 447 Query: 448 GKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 G NF E+V D ++D L+E Y ++L P Sbjct: 448 GDNFDEIVLDDSKDVLLEVYAPWCGHCQALEP 479 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSKK 689 PWCGHCQ LAP + +LK++ V + KIDAT + ++ V GFPT+ + D K Sbjct: 130 PWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTLLFF-VDGEHK 188 Query: 690 P 692 P Sbjct: 189 P 189 Score = 55.2 bits (127), Expect = 4e-08 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKP 671 PWCGHCQ L P++ +L + L+ + + I K+D T N+ PK++ GFPTI + P Sbjct: 469 PWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAK--AEGFPTILFFP 521 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 65.7 bits (153), Expect = 3e-11 Identities = 34/92 (36%), Positives = 50/92 (54%), Gaps = 1/92 (1%) Frame = +1 Query: 271 GDKPVVAGRDADGNKFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIPE-NDGPVKVAV 447 G K + + D K+ E + + F +D L+ KL+PF KS+ IPE ND VK+ V Sbjct: 388 GPKLIGYTGNEDPKKYFFDGEIQSDKIKIFGEDFLNDKLKPFYKSDPIPEKNDEDVKIVV 447 Query: 448 GKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 G NF E+V D ++D L+E Y ++L P Sbjct: 448 GDNFDEIVLDDSKDVLLEVYAPWCGHCQALEP 479 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSKK 689 PWCGHCQ LAP + +LK++ V + KIDAT + ++ V GFPT+ + D K Sbjct: 130 PWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTLLFF-VDGEHK 188 Query: 690 P 692 P Sbjct: 189 P 189 Score = 55.2 bits (127), Expect = 4e-08 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKP 671 PWCGHCQ L P++ +L + L+ + + I K+D T N+ PK++ GFPTI + P Sbjct: 469 PWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAK--AEGFPTILFFP 521 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 65.7 bits (153), Expect = 3e-11 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 PWCGHC+KLAP +E+LG K + V I K+D +++ VSG+PTI W PK S Sbjct: 50 PWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPK-GSL 108 Query: 687 KPQRY 701 +PQ+Y Sbjct: 109 EPQKY 113 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEE-VDIIKIDATANDWPKSQFDVSGFPTIFWKPKDS 680 PWCGHC+ LAP +E++ K EE V I +DA A+ ++ VSGFPT+ + PKD+ Sbjct: 169 PWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDN 226 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = +1 Query: 397 VKSEAIPENDGPVKVAVGKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 VK A+P+N V V NF E+V D N+D L+EFY +SL P Sbjct: 134 VKLAAVPQN---VVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAP 179 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 65.7 bits (153), Expect = 3e-11 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 PWCGHC+KLAP +E+LG K + V I K+D +++ VSG+PTI W PK S Sbjct: 50 PWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPK-GSL 108 Query: 687 KPQRY 701 +PQ+Y Sbjct: 109 EPQKY 113 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEE-VDIIKIDATANDWPKSQFDVSGFPTIFWKPKDS 680 PWCGHC+ LAP +E++ K EE V I +DA A+ ++ VSGFPT+ + PKD+ Sbjct: 169 PWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDN 226 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = +1 Query: 397 VKSEAIPENDGPVKVAVGKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 VK A+P+N V V NF E+V D N+D L+EFY +SL P Sbjct: 134 VKLAAVPQN---VVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAP 179 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 56.0 bits (129), Expect = 2e-08 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSS 683 PWCGHC+KLAP W++ LK +V + ++ A KS+F V GFPTI D S Sbjct: 191 PWCGHCKKLAPEWKKAANNLKG-KVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKS 247 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/50 (46%), Positives = 28/50 (56%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCGHCQ L P WE++ LK + IDA A+ + V GFPTI Sbjct: 56 PWCGHCQSLTPTWEKVASTLKG-IATVAAIDADAHKSVSQDYGVRGFPTI 104 Score = 31.1 bits (67), Expect = 0.74 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 5/99 (5%) Frame = +1 Query: 262 FAKGDKPVVAGRDADGNKFVMS-AEFSIENLLTFTKDLLDGKLEPFVKSEAIPE---NDG 429 F G P+ D G + S ++F+I+ + KD LDGK E ++ Sbjct: 107 FVPGKPPI----DYQGARDAKSISQFAIKQIKALLKDRLDGKTSGTKNGGGSSEKKKSEP 162 Query: 430 PVKVAVGK-NFKELVTDSNRDALIEFYGHGADTVRSLLP 543 V + NF ELVT+S ++EF+ + L P Sbjct: 163 SASVELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAP 201 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 394 FVKSEAIPENDGPVKVAVGKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 F + A+ + PV NFK V +SN L+EF+ +SL P Sbjct: 17 FDRGNALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTP 66 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIF-WKPKDSSK 686 PWCGHC+KLAP W+ + L+ +V + ++ S+F V GFPTI + P SS Sbjct: 190 PWCGHCKKLAPEWKRAAKNLQG-KVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSP 248 Query: 687 KP 692 P Sbjct: 249 YP 250 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/50 (42%), Positives = 28/50 (56%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCGHC+ L P WE++ LK + IDA A+ + + GFPTI Sbjct: 58 PWCGHCKALTPTWEKVANILKG-VATVAAIDADAHQSAAQDYGIKGFPTI 106 Score = 30.7 bits (66), Expect = 0.98 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = +1 Query: 262 FAKGDKPVVAGRDADGNKFVMS-AEFSIENLLTFTKDLLDGKLEPFVKSEAIPENDGPVK 438 F G P+ D G + S A F+ + + D L+GK +P +++ Sbjct: 109 FVPGKAPI----DYQGARDAKSIANFAYKQIKGLLSDRLEGKSKPTGGGSKEKKSEPSAS 164 Query: 439 VAVG-KNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 V + NF +LV +SN ++EF+ + L P Sbjct: 165 VELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAP 200 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 394 FVKSEAIPENDGPVKVAVGKNFKELVTDSNRDALIEFYGHGADTVRSLLP 543 F S A+ + PV NFK V +SN L+EF+ ++L P Sbjct: 19 FDLSSALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTP 68 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/62 (30%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPT--IFWKPKDS 680 PWC HC+KL +WE+LG+ ++ D+E+++ ++D + ++ ++ +PT +F+ ++ Sbjct: 53 PWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEV 112 Query: 681 SK 686 SK Sbjct: 113 SK 114 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/62 (30%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPT--IFWKPKDS 680 PWC HC+KL +WE+LG+ ++ D+E+++ ++D + ++ ++ +PT +F+ ++ Sbjct: 53 PWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEV 112 Query: 681 SK 686 SK Sbjct: 113 SK 114 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/62 (30%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK-DEEVDIIKIDATANDWPKSQFDVSGFPT--IFWKPKDS 680 PWC HC+KL +WE+LG+ ++ D+E+++ ++D + ++ ++ +PT +F+ ++ Sbjct: 53 PWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEV 112 Query: 681 SK 686 SK Sbjct: 113 SK 114 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKI--DATANDWPKSQFDVSGFPTIFWKPKDSS 683 PWC CQ + ++EL +KL V + K D D+ K + + FPTI PK+SS Sbjct: 376 PWCPFCQAMEASFDELADKLGGSGVKVAKFRADGDQKDFAKKELQLGSFPTILVFPKNSS 435 Query: 684 KKPQRY 701 +P +Y Sbjct: 436 -RPIKY 440 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKI--DATANDWPKSQFDVSGFPTIFWKPKDSS 683 PWC CQ + ++EL +KL + + K D ++ K + + FPTI PK+SS Sbjct: 383 PWCPFCQAMEASYDELADKLAGSGIKVAKFRADGDQKEFAKQELQLGSFPTILVFPKNSS 442 Query: 684 KKPQRY 701 +P +Y Sbjct: 443 -RPIKY 447 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = +1 Query: 277 KPVVAGRDADGN-KFVMSAEFSIENLLTFTKDLLDGKLEPFVKSEAIPENDGPVKVA-VG 450 K VVA D + N K+++ ++ S N+ F L G + + KS+ IP+N VA VG Sbjct: 364 KTVVAAFDNNLNSKYLLESDPSPSNIEEFCFGLAHGTVSAYYKSQPIPDNQNASVVAVVG 423 Query: 451 KNFKELVTDSNRDALIEFY 507 + F E+V S+ + L+E + Sbjct: 424 RTFDEVVLRSSENVLLEVH 442 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 PWC +C+ L+ E+L + K E + +IDA+AN+ PK V +PTI + Sbjct: 444 PWCINCEALSKQVEKLSQHFKGFENLVFARIDASANEHPK--LTVDDYPTILLYKTGEKE 501 Query: 687 KP 692 P Sbjct: 502 NP 503 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD--EEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWC +L P + E LK+ V + KID SQ ++ GFPT+ Sbjct: 102 PWCARSAELMPRFAEAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGFPTL 153 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKI--DATANDWPKSQFDVSGFPTIFWKPK 674 PWC CQ + + EL EKL + V + K D ++ K + + FPTI PK Sbjct: 372 PWCPFCQAMEASYIELAEKLAGKGVKVAKFRADGEQKEFAKQELQLGSFPTILLFPK 428 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT 656 WCG CQ + P+ E+ E LKD ++ ++KID +++ + PT Sbjct: 92 WCGPCQFMVPILNEVSETLKD-KIQVVKIDTEKYPSIANKYKIEALPT 138 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT 656 WCG CQ + P+ E+ E LKD + ++KID +++ + PT Sbjct: 87 WCGPCQLMVPILNEVSETLKD-IIAVVKIDTEKYPSLANKYQIEALPT 133 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 WCG C+ L P EEL K D E I +D + W +F++S P I Sbjct: 70 WCGPCKTLEPKLEELAAKYTDVEFVKIDVDVLMSVW--MEFNLSTLPAI 116 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD-EEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 PWC +C+ L+ E+L + K E + +IDA+AN+ K Q D +P I + Sbjct: 445 PWCVNCEALSKQIEKLAKHFKGFENLVFARIDASANEHTKLQVD-DKYPIILLYKSGEKE 503 Query: 687 KP 692 KP Sbjct: 504 KP 505 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD--EEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWC +L P + E LK+ V + KID S+ ++ GFPT+ Sbjct: 104 PWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGFPTL 155 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/60 (36%), Positives = 32/60 (53%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSKKP 692 WCG C+ + P E L ++ D ++ I+KID AN ++F V G P F KD + P Sbjct: 98 WCGPCKLIYPAMEALSQEYGD-KLTIVKIDHDANPKLIAEFKVYGLPH-FILFKDGKEVP 155 >At3g62510.1 68416.m07023 protein disulfide isomerase-related contains weak similarity tot Swiss-Prot:P80284 protein disulfide isomerase precursor (PDI) (Endosperm protein E-1) [Hordeum vulgare] Length = 93 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +1 Query: 331 EFSIENLLTFTKDLLDGKLEPFVKSEAIP-ENDGPVKVAVGKNFKELVTDSNR 486 E ++ + ++ KD DGK S+ IP EN+ PVK+ V ++ ++V S R Sbjct: 7 EVEVDQIESWVKDFQDGKAAVHKNSQPIPAENNEPVKLVVAESLDDIVQVSER 59 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT 656 WCG C+ + P + +K D VD +K+D +F+V+ PT Sbjct: 58 WCGPCRMIEPAIHAMADKFND--VDFVKLDVDELPDVAKEFNVTAMPT 103 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 34.7 bits (76), Expect = 0.060 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWP 623 WCG C+ +AP ++EL EK +D + +K+D ++ P Sbjct: 108 WCGPCKVIAPKYKELSEKYQD--MVFLKLDCNQDNKP 142 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 34.3 bits (75), Expect = 0.079 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLK---DEEVD----IIKIDATANDWPKSQFDVSGFPTI 659 PWC C L P WE+ +++K D E+D + K+D T + + G+P+I Sbjct: 168 PWCYWCNLLKPSWEKAAKQIKERYDPEMDGRVILAKVDCTQEGDLCRRNHIQGYPSI 224 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 34.3 bits (75), Expect = 0.079 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELG---EKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCGHC++L P + KLK + + I K++A + ++ FPT+ Sbjct: 59 PWCGHCKRLNPELDAAAPILAKLK-QPIVIAKLNADKYSRLARKIEIDAFPTL 110 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCG C+ + P+ EL +K + K++ + Q+ V PTI Sbjct: 102 PWCGPCKMIDPIVNELAQKYAG-QFKFYKLNTDESPATPGQYGVRSIPTI 150 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDE---EVDIIKIDATANDW 620 WCG C+ +AP + +L +KL + +VD ++ + A+DW Sbjct: 39 WCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDW 77 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFW 665 WCG C+ +AP + EL EK ++ +D ++ S +D+ PT F+ Sbjct: 56 WCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDF--SSSWDIKATPTFFF 104 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 33.1 bits (72), Expect = 0.18 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT-IFWK 668 WC C+ +APV+ +L +K D V K+D + +F V PT IF K Sbjct: 38 WCPPCRFIAPVFADLAKKHLD--VVFFKVDVDELNTVAEEFKVQAMPTFIFMK 88 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSK 686 WCG C +A E L + + + I+K+D V G PT+F+ D SK Sbjct: 105 WCGPCILMAQELEMLAVEYESNAI-IVKVDTDDEYEFARDMQVRGLPTLFFISPDPSK 161 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWP 623 WCG C+ +AP ++ L EK D V +K+D ++ P Sbjct: 98 WCGPCKVIAPKYKALSEKYDD--VVFLKLDCNPDNRP 132 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSSKK 689 WCG C+ ++PV EL ++ D + ID S+ +++ PT+ + K SKK Sbjct: 117 WCGPCRFISPVIVELSKQYPDVTTYKVDIDEGGISNTISKLNITAVPTLHFF-KGGSKK 174 >At2g26190.1 68415.m03145 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 532 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = +3 Query: 504 LWPWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTIFWKPKDSS 683 +WP+ GH + E L++ VD+ + + + S F+ SG+ K +++ Sbjct: 365 IWPYSGHYLPTEDNFNEFISFLEENNVDMTNVKRCSVNEEYSSFNSSGYEEEATKEEEAE 424 Query: 684 KKP 692 KKP Sbjct: 425 KKP 427 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI-FWK 668 WCG C+ ++PV EL K D + ID + +VS PT+ F+K Sbjct: 82 WCGPCRLISPVILELSNKYPDVTTYKVDIDEGGLSNAIGKLNVSAVPTLQFFK 134 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 32.3 bits (70), Expect = 0.32 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT-IFWK 668 WC C+ +APV+ E+ +K + V KID +F V PT +F K Sbjct: 38 WCPPCRFIAPVFAEMAKKFTN--VVFFKIDVDELQAVAQEFKVEAMPTFVFMK 88 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT 656 WC C+ +AP++ +L +K + K+D +F V PT Sbjct: 39 WCPPCRMIAPIFNDLAKKFMSSAI-FFKVDVDELQSVAKEFGVEAMPT 85 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 30.7 bits (66), Expect = 0.98 Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPK--SQFDVSGFPTIFWKPKDSSK 686 WC C++LAP ++ ++ KD +V+ + ++ W + +F V G P + ++ ++ Sbjct: 149 WCEVCRELAPDVYKIEQQYKD-KVNFVMLNVDNTKWEQELDEFGVEGIPHFAFLDREGNE 207 Query: 687 K 689 + Sbjct: 208 E 208 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 30.7 bits (66), Expect = 0.98 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCG C+ + P+ +L + ++ K++ + Q+ V PTI Sbjct: 108 PWCGPCKMIDPLVNDLAQHYTG-KIKFYKLNTDESPNTPGQYGVRSIPTI 156 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 30.7 bits (66), Expect = 0.98 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKD---EEVDIIKIDATANDW 620 PWC C+K+ PV+ +L + VD+ ++ +N+W Sbjct: 18 PWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEFSNEW 57 >At4g16745.1 68417.m02529 exostosin family protein contains Pfam PF03016: Exostosin family Length = 542 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 528 DSVRTMAIEFYECVPVAVRDQFLEVLADGYLHWA 427 +S R + +YECVPV + D F+ +D L W+ Sbjct: 432 NSPRIVEAIYYECVPVVIADNFMLPFSD-VLDWS 464 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDA-TANDWPKSQFDVSGFPT 656 WCG C+ ++P++ L + V +K+D AND S +++S PT Sbjct: 303 WCGPCRYMSPLYSNLA--TQHSRVVFLKVDIDKANDVAAS-WNISSVPT 348 >At4g20770.1 68417.m03016 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 740 Score = 29.1 bits (62), Expect = 3.0 Identities = 34/108 (31%), Positives = 44/108 (40%), Gaps = 3/108 (2%) Frame = -3 Query: 588 CQLLHLSTFHQALPRREQASDS-VRTMAIEFY-ECVPVAVRDQFLE-VLADGYLHWAVVF 418 C LLH FH + + SDS V T + Y +C + QF + VL + W + Sbjct: 499 CSLLHGRQFHGLVVKSGYVSDSFVETALTDMYCKCGEIDSARQFFDAVLRKNTVIWNEMI 558 Query: 417 RYGLGFHEWLQLAIEQVLCER**IFDAELRAHDEFVSVCVAAGHYGLV 274 +G G + E V R I E FVSV A H GLV Sbjct: 559 -HGYGHN---GRGDEAVGLYRKMISSGEKPDGITFVSVLTACSHSGLV 602 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/50 (22%), Positives = 25/50 (50%) Frame = +3 Query: 510 PWCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPTI 659 PWCG C+ + P+ ++L + + KI+ + +++ + PT+ Sbjct: 114 PWCGPCRMIHPIVDQLAKDFAG-KFKFYKINTDESPNTANRYGIRSVPTV 162 >At1g33790.1 68414.m04177 jacalin lectin family protein similar to myrosinase binding protein homolog GI:2997767 from [Arabidopsis thaliana]; contains contains Pfam profile PF01419 jacalin-like lectin domain Length = 445 Score = 29.1 bits (62), Expect = 3.0 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 6/104 (5%) Frame = +1 Query: 244 QRVRIDFAKGDKPVVAGRDADGN-----KFVMSAEFSIENLLTFTKDLLDGKLEPFVKSE 408 +++RID+ KG ++ R+ GN +FV+ + T D++ + V+S Sbjct: 187 RQIRIDYDKGG--LIERREYGGNVGRQEEFVVDYPSEYIIYMEGTCDIVSDASKNRVRSL 244 Query: 409 AIPENDGPVKVAVGK-NFKELVTDSNRDALIEFYGHGADTVRSL 537 + G GK ++ V +SN ALI F+G A V ++ Sbjct: 245 MFKTSKGRTSPIFGKVAARKFVFESNGSALIGFHGRAAAAVDAI 288 >At4g32790.1 68417.m04665 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 593 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 528 DSVRTMAIEFYECVPVAVRDQFLEVLADGYLHW 430 +S R + FYECVPV + D F+ + L+W Sbjct: 494 NSPRVVEALFYECVPVIISDNFVPPFFE-VLNW 525 >At5g19670.1 68418.m02340 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 600 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 528 DSVRTMAIEFYECVPVAVRDQFL 460 +S R + FYECVPV + D F+ Sbjct: 498 NSPRVVESIFYECVPVIISDNFV 520 >At4g37590.1 68417.m05320 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 580 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +1 Query: 331 EFSIENLLTFTKDLLDGKLEPFVKSEAIPENDGPVKVAVGKNFKELVTDSNRDA 492 E ++ ++L + +L+ +E F+KS E+D K +V K + + +RD+ Sbjct: 326 EANLGDVLLYDVELMQSLVEVFLKSRDPREDDVTAKASVAKLVDGYLAEKSRDS 379 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +3 Query: 513 WCGHCQKLAPVWEELGEKLKDEEVDIIKIDATANDWPKSQFDVSGFPT 656 WCG C+ + P+ ++ + K+ E ++ +FD+S PT Sbjct: 238 WCGPCRDMIPILNKMDSEYKN-EFKFYTVNFDTEIRFTERFDISYLPT 284 >At5g25820.1 68418.m03064 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 654 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 528 DSVRTMAIEFYECVPVAVRDQFLEVLADGYLHW 430 +S R + FY+CVPV + D F+ + L+W Sbjct: 553 NSPRVVEAIFYDCVPVIISDNFVPPFFE-VLNW 584 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,874,806 Number of Sequences: 28952 Number of extensions: 263016 Number of successful extensions: 907 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -