BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30302X (490 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.04 |tef5||translation elongation factor EF-1 beta subun... 64 8e-12 SPBC887.02 |||ClC chloride channel|Schizosaccharomyces pombe|chr... 26 3.5 SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 25 4.6 SPBC1347.02 |fkbp39||FKBP-type peptidyl-prolyl cis-trans isomera... 25 4.6 SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 6.1 SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 25 8.1 SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 25 8.1 >SPCC1450.04 |tef5||translation elongation factor EF-1 beta subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 214 Score = 64.5 bits (150), Expect = 8e-12 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +3 Query: 36 MAVGDVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQGFEQVGKAP-AANLPHVLRWYNQI 212 M D+ + GL LN +L +KS++ GY PSQAD F+ VG AP A P+ RWY QI Sbjct: 1 MGFSDLTSDAGLKQLNDFLLDKSFIEGYEPSQADAVVFKAVGVAPDTAKYPNGARWYKQI 60 Query: 213 ASYTSA 230 A+Y A Sbjct: 61 ATYDLA 66 Score = 38.7 bits (86), Expect = 5e-04 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 410 KKSKKPALIAKSSILLDVQPWDDDTDM 490 KK+ KP + KS + LDV+PWDD+T M Sbjct: 118 KKAAKPKAVHKSLVTLDVKPWDDETPM 144 >SPBC887.02 |||ClC chloride channel|Schizosaccharomyces pombe|chr 2|||Manual Length = 667 Score = 25.8 bits (54), Expect = 3.5 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 233 FSRSV*SNLIIPS*YVGKVSGRRLANLLKSLNISLRRS----VSRHVAFLS 93 F ++ + +I+PS +G GR + LLKS SL + V +AFLS Sbjct: 402 FGAAIPTGIIVPSLAIGACIGRAVGTLLKSRFPSLAGTSIYGVIGSIAFLS 452 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 25.4 bits (53), Expect = 4.6 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +1 Query: 112 LDTLLLKLMFKDLSKLARRRPLTFPTYYDGIIKLLHTLRLNAKHGLRAQPIDRRC 276 LDTLL L +DL+ PLT T + KLL +N H Q +D C Sbjct: 194 LDTLL-PLEIEDLALPLSLYPLTVLTQNPNLPKLLERPDINDLHQGILQELDSLC 247 >SPBC1347.02 |fkbp39||FKBP-type peptidyl-prolyl cis-trans isomerase|Schizosaccharomyces pombe|chr 2|||Manual Length = 361 Score = 25.4 bits (53), Expect = 4.6 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 12 KVATLKETMAVGDVKTAQGLNDLNQYLAEKSYV 110 K TLK + V DVKT G + N E Y+ Sbjct: 251 KTRTLKGGVVVTDVKTGSGASATNGKKVEMRYI 283 >SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 25.0 bits (52), Expect = 6.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 207 DYTIVVRGEG*RPAPCQLAQILEHQLE 127 +Y +VV G G P C + L QLE Sbjct: 308 NYPVVVNGNGVNPYLCDVQAFLTSQLE 334 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 24.6 bits (51), Expect = 8.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 109 CLDTLLLKLMFKDLSKLARRRP 174 CLD LL L +DL ++A +RP Sbjct: 482 CLDNLLSVLPNEDLMEIADKRP 503 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 24.6 bits (51), Expect = 8.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 225 KCMKQFDYTIVVRGEG*RPAPCQLAQILE 139 +C+K DY R +G +P + Q+LE Sbjct: 2710 RCLKALDYIFERRPKGQEQSPGNIIQLLE 2738 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,601,155 Number of Sequences: 5004 Number of extensions: 25679 Number of successful extensions: 70 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 190087364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -