BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30302X (490 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59042| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 4e-16 SB_52162| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_6056| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-14) 27 8.3 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 27 8.3 >SB_59042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 81.4 bits (192), Expect = 4e-16 Identities = 35/62 (56%), Positives = 43/62 (69%) Frame = +3 Query: 36 MAVGDVKTAQGLNDLNQYLAEKSYVSGYTPSQADVQGFEQVGKAPAANLPHVLRWYNQIA 215 M GD+K+ GL+ LN +L E+SY+ GY PSQAD FE + AP A+LPH LRWYN I Sbjct: 1 MGFGDLKSQAGLSALNTFLTERSYIEGYVPSQADAVVFEALKSAPPASLPHALRWYNHIV 60 Query: 216 SY 221 SY Sbjct: 61 SY 62 Score = 50.4 bits (115), Expect = 8e-07 Identities = 24/53 (45%), Positives = 31/53 (58%) Frame = +2 Query: 332 LFGSGDXXXXXXXXXXXXXXXXXXXDKKSKKPALIAKSSILLDVQPWDDDTDM 490 LFGS D +KK+KK +IAKS+I+LDV+PWDD+TDM Sbjct: 103 LFGSDDEEEEKEAARIRQERLKAYEEKKAKKKPVIAKSNIMLDVKPWDDETDM 155 >SB_52162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 52.0 bits (119), Expect = 3e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +3 Query: 117 YTPSQADVQGFEQVGKAPAANLPHVLRWYNQIASY 221 Y PSQAD FE + AP A+LPH LRWYN I SY Sbjct: 2 YVPSQADAVVFEALKSAPPASLPHALRWYNHIVSY 36 >SB_6056| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-14) Length = 270 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 472 PWLDIKENRGLGNESWFLRLLVSIC 398 P L+ K+NRGLGNE L +S+C Sbjct: 113 PELNPKDNRGLGNEVPETTLELSLC 137 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 69 LNDLNQYLAEKSYVSGYTPSQADVQ 143 +N L + L EKS+ GY+P+ +DVQ Sbjct: 62 VNKLPKGLIEKSWNFGYSPNTSDVQ 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,307,238 Number of Sequences: 59808 Number of extensions: 200937 Number of successful extensions: 377 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -