BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30302X (490 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 24 3.2 AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 23 5.6 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 22 9.8 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 9.8 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.8 bits (49), Expect = 3.2 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 487 IGVIIPWLDIKENRGLGNESWFLRL 413 + +I P+LD++EN G G+ F+ L Sbjct: 76 VRIIDPYLDLEENWGRGHIKRFVGL 100 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 23.0 bits (47), Expect = 5.6 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 192 LRWYNQIASYTSAERKTWS 248 LRW+N +A + + WS Sbjct: 54 LRWHNVVAKRVRRQHRDWS 72 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +3 Query: 183 PHVLRWYNQIASYTSAERKTWSQG 254 P V +W+ ++ S + K+ +QG Sbjct: 164 PEVQQWFEELKEKRSLQEKSTNQG 187 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.2 bits (45), Expect = 9.8 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -2 Query: 207 DYTIVVRGEG*RPAPCQLAQILEHQLEKECIQTRSFS 97 +++ + G G R C ++ LE QL + SFS Sbjct: 188 EFSYITSGSGSRIDRCYVSSSLETQLRTTDMHVLSFS 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 402,778 Number of Sequences: 2352 Number of extensions: 6837 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -